KEGG   Mycoplasma pullorum: BLA55_01235Help
Entry
BLA55_01235       CDS       T05055                                 

Definition
(GenBank) lysine--tRNA ligase
  KO
K04567  lysyl-tRNA synthetase, class II [EC:6.1.1.6]
Organism
mpul  Mycoplasma pullorum
Pathway
mpul00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mpul00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BLA55_01235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mpul01007]
    BLA55_01235
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mpul03016]
    BLA55_01235
Enzymes [BR:mpul01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.6  lysine---tRNA ligase
     BLA55_01235
Amino acid related enzymes [BR:mpul01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BLA55_01235
Transfer RNA biogenesis [BR:mpul03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BLA55_01235
 Prokaryotic type
   Other AARSs
    BLA55_01235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d T4_neck-protein IFT20
Motif
Other DBs
NCBI-ProteinID: APJ38298
UniProt: A0A1L4FRR2
Position
336817..338283
Genome map
AA seq 488 aa AA seqDB search
MSKYTEQELVRRKKLDFYKENNVKAFKNADDLKELSYSDDITKKYQEYTREELEEKAFPV
NLSGRIMTMRGPFIVIQDYHGRMQVYFNKKENAELAKIVETFDLGDIIYVEGVVMKTHTD
QVSVRSYNIELLTKALKPLPDKFHGLVDVEERYRHRYVDLIMNEESRKTFWTRTKIISEI
RRYFDELEYMEVETPFLHDYLSGAAARPFKTHHNALDQEFVLRIATEIPLKKLLVGGIDR
VYEIGRIFRNEGIDTTHNPEFTSIEFYEAYSNLEGMMQRTEELFKRLAKKLGKEKVMNNG
VEIDLTKPFARVDMVQAVSEATGLDFKNASEAQILEVAKKHHIKIEKYFTIGHIINELFE
ELIEKTLIQPTFVYGHPIEISPLTAKMDDERFTHRAELFINTKEYANMYTELIDPIDQLE
RFEKQLEEKESGNDEASDIDYDFVDALEYGMPPAGGCGIGIDRLTMLLAEKESIRDVLLF
PTLKRKKK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaatatactgaacaagaattagtaagacgtaaaaaattagatttttataaagaa
aataatgtaaaagcttttaaaaatgctgatgatttaaaagaattaagttacagcgatgat
attactaaaaaatatcaagaatatacacgtgaagagttagaagaaaaagcgtttcctgtg
aacttaagtggacgtattatgacaatgagaggtccatttatcgttattcaagattatcac
ggaagaatgcaagtttactttaataaaaaagaaaatgctgaattagctaaaattgtcgaa
acgttcgacttaggggatattatttatgttgaaggtgttgttatgaaaacacacactgac
caagtttcggttcgttcatacaacattgaattattaactaaagcattaaaacctttacct
gacaaattccatggattagttgatgtcgaagaaagataccgtcacagatatgttgattta
atcatgaacgaagaaagcagaaaaacattctgaactagaactaaaattatttctgaaatt
cgtagatattttgatgaattagaatacatggaagttgaaacaccatttttacacgattat
ttatctggtgctgctgctcgtcctttcaaaacacatcacaacgcacttgatcaagaattt
gtcttgagaattgcaactgaaattcctcttaaaaaattattagttggtggaattgaccgc
gtttatgaaattggacgtattttcagaaacgaaggaatcgacacaactcacaaccctgaa
tttacctcgattgagttctatgaagcatattcaaaccttgaaggtatgatgcaaagaacc
gaagaattatttaaacgtttagctaagaagttaggtaaagaaaaagttatgaataacggt
gttgaaattgacttaaccaaaccatttgcacgtgtagacatggtgcaggcagtgtcagaa
gcaacaggattagactttaaaaatgctagcgaagcacaaatcttagaagtagcaaaaaaa
caccacattaagattgaaaaatactttacaatcggacacattattaatgaattatttgaa
gaattaattgaaaaaactttaattcaaccaacttttgtttacggacatccaattgaaatt
tcgccattaactgcaaaaatggatgatgagagatttacacatagagctgagttgttcatt
aatacaaaagaatacgctaatatgtatactgagttaattgatccaattgaccaattagag
cgttttgaaaaacaattagaagaaaaagaaagcggaaacgacgaagcaagcgacattgac
tatgatttcgttgatgctttagaatatggaatgcctcctgctggtggatgtggaattgga
attgatcgtttaacaatgttattagctgaaaaagaatctattagagatgttttactattt
ccaactctcaaaagaaagaaaaaataa

DBGET integrated database retrieval system