KEGG   Mycoplasma pullorum: BLA55_02100Help
Entry
BLA55_02100       CDS       T05055                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mpul  Mycoplasma pullorum
Pathway
mpul00450  Selenocompound metabolism
mpul00970  Aminoacyl-tRNA biosynthesis
mpul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpul00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BLA55_02100
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BLA55_02100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mpul01007]
    BLA55_02100
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mpul03016]
    BLA55_02100
Enzymes [BR:mpul01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BLA55_02100
Amino acid related enzymes [BR:mpul01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BLA55_02100
Transfer RNA biogenesis [BR:mpul03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BLA55_02100
 Prokaryotic type
   Other AARSs
    BLA55_02100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Muted
Motif
Other DBs
NCBI-ProteinID: APJ38448
UniProt: A0A1L4FS69
Position
complement(533066..534601)
Genome map
AA seq 511 aa AA seqDB search
MNKKTFYITTPIYYASGNLHIGHLYTTTLAWVLGNYKKLQGYDVKVLTGSDEHGQKIYEK
ALEQNKTPKEFVDETSQKFVQMWEDFKIDVDYFSRTTDEKHCETVQKIFNHFVEKGYIYK
GKYEGWYSVSDEEFLTQSQAIKKDGKMYHPTSGHELKFISEESYFFKLDLFQDWLSNYIE
ANSSFLAPQKTVNEIKNNFLSNLSDLSVTRTNVKWGIPVTIDNKHTIYVWLDALFNYVTK
LGYGFDTKSAEFEKFWENGDEIVHILGKEIARFHFIYWPIFLKALNLKQPNKIQSHGWII
TPTGKMSKSKNNVVDPYDLLQRYHPEMIKYFLASQLPFGEDGIFDEERFKNIINAELINN
FGNLVSRTLKMKSNSFDGPIKYQKSEHVEDLEIEKAITESISQFASYMDEFKIDKGIQIA
VELGNHLNKYIDLTQPWTLKDDLERLEQILVRLLNGIYACATYFSIVLPEKISEVAESLG
LDDFSIKNIEKFDKFDNIDTAEKFMFFERLK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaaacattttatattaccacgccaatttattatgcgtctggaaatttacac
atcggtcacctttacacaacaacacttgcctgagttttaggtaattacaaaaaattacaa
ggatatgatgttaaagttttaacaggtagcgatgagcacggtcaaaagatttacgaaaaa
gcactagaacaaaataaaacacctaaagaattcgttgatgaaacatcacaaaagtttgtt
caaatgtgagaagattttaaaattgatgtggattattttagtcgtacaactgacgaaaaa
cactgtgagacagtacaaaaaatatttaatcactttgttgaaaaaggttacatttacaaa
ggaaaatacgaaggttgatattcagttagcgatgaagaattcttaacccagtctcaagca
attaaaaaagacggtaaaatgtaccatcctactagtggtcacgaattaaaattcatttca
gaagaaagttactttttcaaattagatctttttcaagattggttaagtaattacatcgaa
gcaaattcatcatttttagcaccacaaaaaacagtaaatgagattaaaaacaacttttta
tccaatttaagtgatttaagtgttactcgtaccaatgttaaatgaggtatcccggtcaca
attgataacaaacacactatttatgtttgattggatgctttatttaattatgtaactaaa
ttaggttatggttttgataccaaatctgctgaatttgaaaaattttgagaaaatggtgac
gaaattgtacatattttaggtaaggaaattgctcgtttccactttatttattgaccaatt
ttcttaaaggcattaaacttaaagcaaccaaacaaaattcaaagtcatggttgaattatt
actcctacaggcaaaatgtcaaaatctaaaaataatgtggttgatccttatgatttattg
caaagatatcatccggaaatgatcaaatactttttagcaagtcaattaccatttggtgaa
gatggcatttttgatgaagaaagatttaaaaatattattaatgctgaattaattaataat
tttggtaatttagtttctcgaacactcaaaatgaagtccaattcatttgatggtccaatt
aaatatcaaaaatcagagcatgttgaagatttagaaattgaaaaggcaataactgaatca
attagtcaatttgcaagttacatggatgaatttaaaatcgacaaaggtattcaaatcgca
gtagaattaggaaatcatttaaacaaatatatcgatttaactcaaccttgaactttaaaa
gatgacttagaacgtttagaacaaattttagttcgtttgctcaacggaatttacgcttgt
gcaacatattttagtattgttttaccagaaaaaatttcagaagttgcagaatcacttggt
ttagatgatttttcaataaaaaatattgaaaaattcgataaatttgataatattgatacg
gcggaaaaattcatgtttttcgagagactaaaatag

DBGET integrated database retrieval system