KEGG   Mycoplasma pullorum: BLA55_02495Help
Entry
BLA55_02495       CDS       T05055                                 

Definition
(GenBank) aspartate--tRNA ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
mpul  Mycoplasma pullorum
Pathway
mpul00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mpul00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BLA55_02495
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mpul01007]
    BLA55_02495
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mpul03016]
    BLA55_02495
   03029 Mitochondrial biogenesis [BR:mpul03029]
    BLA55_02495
Enzymes [BR:mpul01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     BLA55_02495
Amino acid related enzymes [BR:mpul01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BLA55_02495
Transfer RNA biogenesis [BR:mpul03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BLA55_02495
 Prokaryotic Type
   Other AARSs
    BLA55_02495
Mitochondrial biogenesis [BR:mpul03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BLA55_02495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d GAD tRNA-synt_2b DUF3217
Motif
Other DBs
NCBI-ProteinID: APJ38515
UniProt: A0A1L4FSB3
Position
616365..618062
Genome map
AA seq 565 aa AA seqDB search
MNKSINNNQLRLTNIGETVTLYGWVANKRKFGELNFVDLRDRYGVTQLVFKEQIHFSKES
VLEVTGLVAERKDKNPNLNTGDIEVIVQEYKVLSTANELPFSIRDDIEVKEDLRLKYRFL
DLRRPIMQKGIILKNQIFQGMREFLQSNDFLELETPILAKATPEGARDFLVPTRNYDQFW
ALPQSPQLFKQLLMVSGFERYYQFARCFRDEDSRKDRQPEFTQLDIEVSFLSVEKFQEII
EKMFQHFMRKIGIEIQIPFQRLNFDDCIRLYGSDKPDLRFDKTIDDIDFFCANSDFNIIK
DKPSKRLLHIDEIISKSEFKKLEEIAKKNKVKSLFYFTYDQQIQSTNFANKVPEAVEELL
KSKNYQSGTYLIVADKYENASQALGALRVELNSWYNWARDEYNFSWIVNWPMFEYDEEND
SWQAAHHPFTQFDNTLEELETLPREKIRAKSYDLVLNGFELGSGSARIYDKQIQERMFNL
IGMDAKQQQEKFGFFLKAFDYGIPPHCGIGLGMDRLVMILSNNKTIRDVIPFPKNAKNQD
VFTEAPSSIAPEQLQELFIKKDKFE
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcaattaataataaccaacttagattaaccaacattggggaaactgtgaca
ctttatggttgagtcgcaaataaaagaaaattcggagaattgaactttgtggacttgcgg
gaccgttacggggtaactcaactagttttcaaagagcaaattcatttttcaaaagaatca
gtcttagaagttacaggtttagtcgcagaacgtaaagataaaaatcccaacttaaacacc
ggggacattgaagttattgttcaagaatacaaagtactctcaaccgctaatgaattacct
ttttcaattcgtgatgacattgaagtcaaagaagatttaagattaaaatatcgtttctta
gacttaagaagaccaattatgcaaaaaggaattattctaaagaaccaaatttttcaaggg
atgcgtgaattcctacaatcaaatgactttttagaattagaaacccctattttggctaaa
gcgaccccagagggggcacgtgactttttagttccaacacgtaactatgatcaattttga
gcattaccacaatctccacaattatttaaacaattattaatggtatctggatttgaacgt
tactaccaatttgctagatgtttccgtgatgaagattcaagaaaagaccgtcaacctgaa
tttacacaattagacatcgaggttagtttcttaagtgttgaaaaattccaagaaattatc
gaaaaaatgtttcaacactttatgcgtaaaattgggattgaaattcaaattccttttcaa
agattaaattttgacgactgtattcgtttatatggtagtgacaaaccagatttaagattt
gataaaacaattgatgatattgatttcttttgtgctaatagcgactttaatattattaaa
gacaaaccatcaaaaagactacttcacattgatgaaattatttcaaaatcagaatttaag
aaattagaagaaatcgctaagaaaaacaaagtaaaatcactattttactttacttatgat
caacaaattcaatcaactaacttcgcaaacaaagttcctgaagcagttgaagaattatta
aaatccaaaaattatcaatcaggtacctatttaatagttgcagataaatatgaaaacgct
tctcaagcattaggtgctttgcgtgttgaattaaatagttgatataactgagctcgtgac
gagtacaatttctcatgaatcgtaaattgaccaatgtttgaatatgatgaagaaaatgat
agttgacaagctgcacaccatccatttactcaatttgataatactttagaagaattagaa
actttaccacgtgaaaaaattcgtgcaaaaagctatgacttagttcttaatggttttgaa
ttaggttctggctcagccagaatttacgacaaacaaattcaagaaagaatgttcaatcta
attggtatggacgctaaacaacaacaagaaaaattcggtttcttcttaaaagcatttgat
tatggtattccaccacactgtgggattggtttaggtatggaccgtttagtgatgatttta
tcaaacaataaaactattcgtgatgttattccgtttccaaaaaacgcaaaaaatcaagac
gtctttaccgaagcaccgagctcaattgcacctgaacaacttcaagagttgtttatcaaa
aaagacaaattcgaataa

DBGET integrated database retrieval system