KEGG   Marichromatium purpuratum: MARPU_00105Help
Entry
MARPU_00105       CDS       T03650                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mpur  Marichromatium purpuratum
Pathway
mpur00020  Citrate cycle (TCA cycle)
mpur00620  Pyruvate metabolism
mpur01100  Metabolic pathways
mpur01110  Biosynthesis of secondary metabolites
mpur01120  Microbial metabolism in diverse environments
mpur01130  Biosynthesis of antibiotics
mpur01200  Carbon metabolism
Module
mpur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mpur_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mpur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MARPU_00105
   00620 Pyruvate metabolism
    MARPU_00105
Enzymes [BR:mpur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     MARPU_00105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO NAD_binding_9 Pyr_redox_3 Pyr_redox_2 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AHF02429
UniProt: W0DZL1
Position
complement(25767..27176)
Genome map
AA seq 469 aa AA seqDB search
MNPSTHYDVLIVGAGVTGTALLYELAKFTDLGRLCLVEKYDDVATVNSHAHSNSQTIHCG
DIETNYTLEKARSVKRTAYMVINYATKLPAEERDRIIQRMPKMVLGVGAEECRYIRERHA
RFKGLFPRMELLEREAIAELEPNVARVEGRWRAEEIVATGTADEYCAVDFQALAQSFSDA
CARLDRNSGKQITQLFSTKVESIRKEGGDYVLRTNRGLLQARAVVVCAGGHSLLMAQEMG
LGLEYSCLPVAGSFYFAPEALNGKVYTVQNPNLPFAAVHGDHDVKERGKTRFGPTALMLP
MLERYNRSSIREFFKVQRFDHDVAAVVWDLMKVPDIRNYVLRNFLYEVPWLNRQLFVREI
RKIVPALQASEISYAEGFGGIRPQLIDKRARKLRMGEAKISDGGGIIFNMTPSPGGTSCL
GAGEGDMRAIAEYLGARIDERAFEQELLMGHEDTRDHEDPATEALATAV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatcgacccactacgacgtactcatcgtcggtgccggcgtcaccggcaccgcc
ctgctctacgaactggccaagttcaccgatctcgggcggttgtgcctggtggagaagtac
gacgacgtcgccacggtcaactcacacgcccacagcaacagccagaccatccactgcggc
gacatcgagaccaactacaccctggagaaggcgcgttcggtcaagcgtaccgcctacatg
gtgatcaactacgccaccaagctgcccgccgaggagcgcgaccgtatcatccagcgcatg
cccaagatggtgctcggtgtcggcgccgaggagtgtcgctatatccgcgagcgccacgcc
cggttcaagggactattcccacgcatggagttgctcgagcgcgaggcgatcgccgaactc
gagcccaatgtggcacgggtcgaaggccggtggcgcgccgaggagatcgtcgccacggga
accgccgacgagtactgcgcggtcgacttccaggcactggcacagtccttctccgatgct
tgcgcacgtctcgaccgcaacagcggcaagcagatcacccagctgttttcgaccaaggtc
gagtcgatccgcaaggagggcggggactatgtgctgcgcaccaaccgcggcctgctacag
gcgcgcgcggtggtggtctgcgccggggggcactcgctgctgatggcccaggagatgggg
ctgggactggagtattcctgtttgccggtagccggctccttctacttcgcccccgaagca
ctcaacggcaaggtctacaccgtccagaaccccaatctgcccttcgccgcggtgcacggc
gaccacgacgtcaaggagcgcggcaagacccgcttcggccccaccgcactgatgctgccg
atgctcgagcgctacaaccgatcgagcatccgcgagttcttcaaggtgcagcgcttcgat
catgatgtggcggcagtcgtgtgggacctgatgaaggtgcccgatatccgcaactatgtg
ctgcgcaacttcctctacgaggtgccctggctcaaccgtcagctgttcgtgcgcgagatc
cgcaagatcgtccccgcgctccaggcctcagagatcagctatgccgagggcttcggcggg
atccgcccacagctcatcgacaagcgcgcacgcaagctgcgcatgggcgaggccaagatc
agcgacggcggcggcatcatcttcaacatgaccccgtcccccggcggcaccagctgtctc
ggtgctggcgagggcgacatgcgcgccatcgccgagtatctcggcgcccgcatcgacgag
cgtgccttcgagcaggagctgctgatggggcacgaggacacccgcgatcacgaggatccg
gccaccgaggcgctggccacggcggtctga

DBGET integrated database retrieval system