KEGG   Marichromatium purpuratum: MARPU_01375Help
Entry
MARPU_01375       CDS       T03650                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mpur  Marichromatium purpuratum
Pathway
mpur00071  Fatty acid degradation
mpur00072  Synthesis and degradation of ketone bodies
mpur00280  Valine, leucine and isoleucine degradation
mpur00310  Lysine degradation
mpur00362  Benzoate degradation
mpur00380  Tryptophan metabolism
mpur00620  Pyruvate metabolism
mpur00630  Glyoxylate and dicarboxylate metabolism
mpur00640  Propanoate metabolism
mpur00650  Butanoate metabolism
mpur00900  Terpenoid backbone biosynthesis
mpur01100  Metabolic pathways
mpur01110  Biosynthesis of secondary metabolites
mpur01120  Microbial metabolism in diverse environments
mpur01130  Biosynthesis of antibiotics
mpur01200  Carbon metabolism
mpur01212  Fatty acid metabolism
mpur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mpur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MARPU_01375
   00630 Glyoxylate and dicarboxylate metabolism
    MARPU_01375
   00640 Propanoate metabolism
    MARPU_01375
   00650 Butanoate metabolism
    MARPU_01375
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MARPU_01375
   00072 Synthesis and degradation of ketone bodies
    MARPU_01375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MARPU_01375
   00310 Lysine degradation
    MARPU_01375
   00380 Tryptophan metabolism
    MARPU_01375
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MARPU_01375
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MARPU_01375
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MARPU_01375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpur04147]
    MARPU_01375
Enzymes [BR:mpur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MARPU_01375
Exosome [BR:mpur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MARPU_01375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FKBP_N
Motif
Other DBs
NCBI-ProteinID: AHF02654
UniProt: W0E0B3
Position
307030..308214
Genome map
AA seq 394 aa AA seqDB search
MSEDIVIVDAGRTAVGNFGGSLSSLPATELGTVVLKALLARTGLDPQRVDEVVLGQVLAA
GVGQNPARQTALNAGLPHGVSAMTINKVCGSGLKAVHLAMQAVACGDAEVVIAGGQESMS
QSSHVLPRSRDGQRMGDWKLKDTMLVDGLTDAFDQCHMGMTAENIAKQYGFTREAQDAFA
ADSQRKAEAAIEAGRFTDEIVPVSIPQRKGEPLVFDRDEFPRAGTTAEKLGRLRPAFDRE
GTVTAGNASGINDGAAMVVVMRASTAAALGLSPMARLVAFASAGVDPKIMGTGPIPASNK
CLKKAGWTPAELDLIEANEAFAAQAMSVNQEMGWDLDKVNVNGGAIALGHPIGASGARVL
VSLLYEMRRREARKGLATLCIGGGQGVALAVERV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagatatcgtcattgtcgacgccggacgtaccgccgtcggcaacttcggtggc
agtctctcctccctgccagccacggaactgggtacggtcgtgctcaaggcactgctggcg
cgcaccggactcgatccgcagcgggtcgacgaggtggtgctcggccaggtgcttgccgcc
ggggtcgggcagaacccggcgcgccagaccgcgctcaatgccgggctgccgcacggggtg
tcggcgatgaccatcaacaaggtctgcggcagtggtctcaaggcggtccacctggcgatg
caggcggtcgcctgtggcgacgccgaggtcgtgatcgccggtggacaggagagcatgagc
cagtcgtcgcacgtgctgccgcgctcgcgcgacggccagcgcatgggcgactggaagctc
aaggacaccatgctggtcgatggactgaccgacgccttcgatcagtgccacatgggcatg
accgcggagaacatcgccaagcagtacggtttcacccgcgaggcgcaggacgccttcgcc
gccgactcgcagcgcaaggccgaggcggcgatcgaggccgggcgcttcaccgacgagatc
gtcccggtgagcatcccgcagcgcaagggcgagccgctggtcttcgatcgcgacgagttc
ccgcgcgccggcaccaccgccgagaagctcgggcggctgcgcccggccttcgaccgcgag
ggtacggtgaccgcgggcaatgcctcggggatcaacgatggcgcggcgatggtggtggtg
atgcgggcatcgaccgccgcggcgctggggctgagcccgatggcgcgactggtcgccttc
gccagcgccggcgtcgaccccaagatcatggggaccggtcccatcccggcctccaacaag
tgcctgaagaaggcgggttggaccccggccgaactcgacctgatcgaggccaacgaggcc
ttcgccgcccaggcgatgtcggtcaaccaggagatgggctgggatctcgacaaggtcaac
gtcaacggcggggcgatcgcgctcggtcatccgatcggcgcctccggcgcccgggtgctg
gtcagcctgctctacgagatgcgtcggcgcgaggcccgcaaggggctggcgaccctgtgc
atcggtggtggtcagggggtcgcgctggccgtcgaacgcgtctga

DBGET integrated database retrieval system