KEGG   Marichromatium purpuratum: MARPU_12235Help
Entry
MARPU_12235       CDS       T03650                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mpur  Marichromatium purpuratum
Pathway
mpur00620  Pyruvate metabolism
mpur00630  Glyoxylate and dicarboxylate metabolism
mpur01100  Metabolic pathways
mpur01110  Biosynthesis of secondary metabolites
mpur01120  Microbial metabolism in diverse environments
mpur01200  Carbon metabolism
Module
mpur_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mpur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MARPU_12235
   00630 Glyoxylate and dicarboxylate metabolism
    MARPU_12235
Enzymes [BR:mpur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MARPU_12235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase Nitr_red_bet_C HD_6
Motif
Other DBs
NCBI-ProteinID: AHF04523
UniProt: W0E4N9
Position
2764978..2767161
Genome map
AA seq 727 aa AA seqDB search
MNERIEIGGLRIATPLYALVRDEIAPGTGIDPEAFWHAFGELVGDLTPRNRALLATRDRL
QRQIDDWHRARRGQRHDAAAYQAFLTEIGYLQPEGPEVQIETRDVDPEIATLAGPQLVVP
VSNARYALNAANARWGSLYDALYGTDAIAEDDGCARGAEYNPKRGAAVVARAAELLDRAV
PLNRGSHSDACAYRVLDGTLLVDLPDNSQTMPRDPAQFVGYRGDPAQPEAILLVNHGLHI
ELVIDPERGVGRESKSGLADILLESALTTIQDCEDSVAAVDTEDKVGVYRNWLGLMKGTL
TARFDKGGRSLERSLAEDRHYTRPDGAALTLPGRALMLVRNVGHLMTTDAVLDAAGEPVP
EGMLDGMVTTLCALHDIHPEHGLHRNSRAGSLYIVKPKMHGPEEVAFAVELFARIEDALG
LARNTLKIGIMDEERRTTLNLKACIGAARERVIFINTGFLDRTGDEIHTDMEAGPVLRKA
EMKQAEWLRAYEDWNVDVGLACGLRGRAQIGKGMWTMPDEMRAMLETKQAHPAAGANCAW
VPSPTAATLHALHYHQIDVAAVQAELAANGPRARLEQLLEIPLGDPAGWTPEQIQQELDN
NCQGILGYVVRWIDQGVGCSKVPDITDVGLMEDRATLRISSQHLANWLHHGVVDRTQVRA
ALERMAAVVDAQNGADPDYRPMAPGFDGVAFTAACELIFAGREAPSGYTEPTLHAMRRRF
KTQQTAV
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacgcatcgagatcggcggtctgcgcatcgccacgcccctgtacgcgctggtc
cgcgacgagatcgcgcccggcaccgggatcgaccccgaggccttctggcacgccttcggc
gagctggtcggcgacctgacgccgcgcaaccgcgcgctgctcgccacccgcgaccggctg
caacgccagatcgacgactggcatcgcgcccgtcgcggccagcggcacgacgccgcggcc
taccaggcctttctcaccgagatcggctatctccagcccgaggggcctgaggtccagatc
gagacccgcgacgtcgaccccgagatcgccaccctcgccggtccccagctggtcgtcccg
gtgagcaacgcccgctatgcgctcaacgccgccaacgcccgctggggcagcctctacgat
gcgctctacggcaccgacgccatcgccgaggacgacggctgcgcgcgtggcgccgagtac
aaccccaagcgcggcgcggcggtggtggcgcgcgccgccgagctgctagaccgggccgta
ccactcaaccgcggctcgcacagcgacgcctgcgcttatcgagtgctcgacggcacgctg
ctcgtcgacctccccgacaacagccagaccatgccgcgcgatcccgcccagttcgtcggc
tatcgcggcgaccccgcgcagcccgaggcgatcctgctggtcaaccacgggctgcacatc
gagctggtgatcgatcccgagcgcggggtcgggcgcgagagcaagtcggggctggccgac
atcctgctggagtcggcgctgaccaccatccaggactgcgaggactcggtcgccgcggtc
gacaccgaggacaaggtcggggtctatcgcaactggctggggctgatgaaggggacgctc
acggcacgcttcgacaagggcggacgcagcctcgagcgcagtctcgccgaggaccgtcac
tacacccgccccgacggcgccgcactgaccctgcccgggcgggcgctgatgctggtgcgc
aacgtcggccacctgatgaccaccgacgcggtgctcgacgccgccggcgagccggtgccc
gagggcatgctcgacggcatggtgaccaccctgtgcgcgctccacgacatccaccccgag
cacggcctgcaccgcaactcgcgcgccggcagcctctatatcgtcaagccgaagatgcac
ggccccgaggaagtcgccttcgccgtcgagctgttcgcccgcatcgaggacgccctgggg
ctggcgcgcaacaccctcaagatcggcatcatggacgaggagcggcgcactacgctcaac
ctcaaggcatgcatcggcgccgcgcgcgagcgggtgatcttcatcaacaccggcttcctc
gaccgcaccggcgacgagatccacaccgacatggaggccgggccggtgctgcgcaaggcg
gagatgaagcaggccgagtggctgcgcgcctacgaggactggaacgtcgacgtcgggctg
gcctgcggactgcgcggacgcgcccagatcggcaagggcatgtggaccatgcccgacgag
atgcgcgccatgctcgagaccaagcaggcccaccccgccgccggcgccaactgcgcctgg
gtgccctcgcccaccgccgccaccctgcacgcgcttcactatcaccagatcgacgtcgct
gcggtgcaggcggagcttgccgccaatggcccccgcgcccgcctcgaacagctcctcgag
atcccgctcggcgaccccgccggctggaccccggagcagatccaacaggagctcgacaac
aactgccagggcatcctcggctatgtggtgcgctggatcgaccagggcgtcggctgctcc
aaggtgcccgacatcaccgacgtcgggctgatggaggaccgcgccaccctgcgcatctcc
agtcagcacctggccaactggctgcaccacggggtggtcgatcggacccaggtacgcgcc
gcgctcgaacgcatggccgcggtggtcgatgcccagaacggcgccgaccccgactaccgg
ccgatggcacccggtttcgacggcgtcgccttcaccgccgcctgcgagctgatcttcgcc
ggacgcgaggcgcccagcggctacaccgagcccaccctccatgccatgcgccggcgcttc
aagacgcagcagaccgccgtctga

DBGET integrated database retrieval system