KEGG   Mycoplasma putrefaciens Mput9231: MPUT9231_4530Help
Entry
MPUT9231_4530     CDS       T02637                                 

Gene name
argS
Definition
(GenBank) Arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
mput  Mycoplasma putrefaciens Mput9231
Pathway
mput00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mput00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MPUT9231_4530 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mput01007]
    MPUT9231_4530 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mput03016]
    MPUT9231_4530 (argS)
   03029 Mitochondrial biogenesis [BR:mput03029]
    MPUT9231_4530 (argS)
Enzymes [BR:mput01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     MPUT9231_4530 (argS)
Amino acid related enzymes [BR:mput01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   MPUT9231_4530 (argS)
Transfer RNA biogenesis [BR:mput03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MPUT9231_4530 (argS)
 Prokaryotic type
   Other AARSs
    MPUT9231_4530 (argS)
Mitochondrial biogenesis [BR:mput03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MPUT9231_4530 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1f tRNA-synt_1 tRNA-synt_1g tRNA-synt_1c DUF1451 GrpE
Motif
Other DBs
NCBI-ProteinID: AGJ90863
UniProt: M9WA40
Position
complement(531739..533400)
Genome map
AA seq 553 aa AA seqDB search
MTTIIEMFKQDLKNICNQLNINKEPIVEINKNNTAGVLATTIALISSKLVAKKPIELAEI
FKQELLKTNRYQSVEIAGPGFINVLIKPELLSTVINNILTAKKDYGQLPDQNYTINIEYV
SANPTGFLHVGHARNATIGSVLVNLWKKAGNKVQTEYYINDAGNQINILAVTVFVHYLWA
LGVKAQKPENSYSGEMYDDLAKMLVEQYQDKFKDLSYTENQIADPLVHDIFKQQAVKYFL
KAIKQQLKNFGVEIEHWSSEQEVYDTNQIAKVLELYQQKDALYQKDQAIWLKTTLFGDDK
DRPLVKSDGTYTYITPDLATHNLRIQRTNADKLVNVWGGDHHGYIPRMRAGLALLGYDPN
ILDIEMVQMVRLIKNGQEFKMSKRKGTAVWLTDIQEMVGKDALRYMLASKSSSSHMDLDL
DLVSQKNASNPVYYAKYATARCNSILKQAKEKNLDFDFKPTNLLTHEKEIELLVTLDNFT
EVIKSAAKNYAPHQICDYIQIIAKQFHSYYADIKIIDQANIVLTTARLGLVKAVLQVLEN
SFDLIGIEATKEM
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaattattgaaatgtttaaacaagatttaaaaaatatttgtaatcaattaaac
attaataaagaaccaattgttgaaattaataaaaataatacagctggagttttagcaaca
accattgcactgataagttcaaaactagtagctaaaaaaccaatcgaactagctgaaatc
tttaaacaagaattactaaaaactaacagatatcaaagtgttgagattgctgggcctggg
tttattaacgttttaataaaaccagaattattatcaacagttattaataatattttaact
gctaaaaaagactatggacaattacctgatcaaaactacacaattaatattgagtatgtt
tcagccaatccaaccgggtttttacatgttggacacgcaagaaacgcaacaattggatca
gttttagtcaatctttgaaaaaaagcaggtaataaagttcaaactgaatattatattaat
gatgcaggaaatcaaattaacattttagctgtcacagtttttgttcattatctatgagca
ttgggagttaaagcacaaaaaccagaaaatagttatagtggtgagatgtatgatgatcta
gcaaaaatgctagttgagcaatatcaagacaaatttaaagatcttagttatactgaaaat
caaattgctgatcctttggttcatgatatttttaaacagcaagctgtgaagtatttttta
aaagctatcaaacaacaattaaaaaattttggtgttgaaattgagcactgatcaagtgaa
caagaagtttatgatactaaccaaattgctaaagttttagagttataccaacaaaaagac
gcgctttatcaaaaagatcaagcaatttggttaaaaacaactttatttggcgatgataaa
gatcgtccattagtcaaatcagatgggacttatacttatatcactccagatttagcaact
cataatttaagaattcaaagaacaaatgctgataaactagtcaatgtttgaggtggagat
catcatggatatattccaagaatgcgtgctggattagcactattgggttatgatcctaac
attttagacattgaaatggtgcaaatggttcgtttaattaaaaatggtcaagaatttaaa
atgagtaaaagaaaaggaactgctgtttgactaactgatattcaagaaatggttggaaaa
gacgctttgagatatatgttagcttctaaatcatcaagttcacatatggatttagactta
gacttggtatctcaaaaaaatgcctcaaacccagtttattatgctaaatatgcaacagct
agatgtaattcgattttaaaacaagcaaaagaaaaaaatcttgattttgattttaaacca
accaacttattaactcatgaaaaagaaattgaattattagttactttagataatttcaca
gaagtgattaaatcagctgcaaaaaactacgcacctcatcaaatttgtgattacattcaa
ataattgccaaacaatttcattcatattatgcagatattaaaattatcgatcaggctaat
atcgtactaacaacagcaagactagggttagttaaagctgttttacaagtattagaaaat
agttttgatttaattggaattgaagccacaaaagaaatgtaa

DBGET integrated database retrieval system