KEGG   Mycoplasma putrefaciens Mput9231: MPUT9231_5990Help
Entry
MPUT9231_5990     CDS       T02637                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mput  Mycoplasma putrefaciens Mput9231
Pathway
mput03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mput00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MPUT9231_5990 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mput03011]
    MPUT9231_5990 (rplV)
Ribosome [BR:mput03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MPUT9231_5990 (rplV)
  Bacteria
    MPUT9231_5990 (rplV)
  Archaea
    MPUT9231_5990 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGJ90996
UniProt: M9WE04
Position
complement(700065..700400)
Genome map
AA seq 111 aa AA seqDB search
MEAKAKLSMIRISPRKVRLVADTIRNKSVANAIAILQNTNKDAVEPVLKLLNSAVANAVN
NNGMDADKLFVKTIFVNEGPTLKRFRPRAHGRAYEIFKRTSHIVIVVSDER
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcaaaattatctatgattcgtatctcacctagaaaagttagattagta
gcagatacaatcagaaacaaatctgtagcaaatgcaattgcaattttgcaaaatactaat
aaagatgcagttgagcctgtattaaaattactaaactcagcagttgctaatgctgttaat
aataatggtatggatgctgataagttatttgttaaaacaatttttgtcaatgaaggacca
acattgaaacgttttagaccaagagctcacggaagagcatatgaaatttttaaaagaact
agtcacattgtgattgtagttagtgacgaaagatag

DBGET integrated database retrieval system