KEGG   Myroides profundi: MPR_0959Help
Entry
MPR_0959          CDS       T03631                                 

Definition
(GenBank) tRNA pseudouridine65 synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
mpw  Myroides profundi
Brite
KEGG Orthology (KO) [BR:mpw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mpw03016]
    MPR_0959
Enzymes [BR:mpw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     MPR_0959
Transfer RNA biogenesis [BR:mpw03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    MPR_0959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 DUF1869
Motif
Other DBs
NCBI-ProteinID: AJH14150
UniProt: A0A0B5RHC3
Position
1036708..1037403
Genome map
AA seq 231 aa AA seqDB search
MLEILYQDEYIVAINKPRDLLVHKSFIASDIQEYAIQILRDQIGQYVYPVHRLDRKTSGV
LLFALDKEILKQLNDDFATRSVEKKYIAIVRGYTIDEETIDYALTNDNGQVQKAKTYYKT
LQRVEIEMPFGKHLTSRYSLVEAYPETGRQHQLRKHFKHIFHPILGSRPHGCNKQNKLWL
DTHGLGAMLLHALELKFTHPVTKETIELRATIDEQYRKYNAVLGFDLEQYY
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaatcctttaccaagacgagtatatagtagcgattaataagccacgtgattta
ttagtacacaaatcttttatagcaagcgacatccaggagtatgctatccagatcttaaga
gatcagatagggcagtatgtgtatcctgtacatcgcttagacagaaagacatcaggcgta
ttattgtttgctttggataaagagattctaaaacagcttaatgatgactttgctacccgt
agtgtagagaagaagtatatcgctatcgtgagaggatatacgatagatgaagagacaatt
gattatgctctaacgaacgacaatggtcaagtacagaaagcaaaaacatattacaaaacc
ttgcagagagtagagatagaaatgccatttggtaagcatttgacttctcgttattctttg
gtagaagcttatcctgagacaggaaggcaacaccaattgcgcaagcattttaaacatatc
tttcaccctattctagggagtcgtccacatggctgtaataagcagaataagctttggctt
gatacacatggattaggagcaatgttattacatgctttagaactgaaatttacacaccct
gttacaaaagaaactatcgaacttagagcaactatcgatgagcagtatcgtaagtataac
gctgtactaggctttgacttagaacaatattattag

DBGET integrated database retrieval system