KEGG   Myroides profundi: MPR_1041Help
Entry
MPR_1041          CDS       T03631                                 

Definition
(GenBank) transcriptional regulator
Organism
mpw  Myroides profundi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transcrip_reg DUF2095
Motif
Other DBs
NCBI-ProteinID: AJH14230
UniProt: A0A0B5RHM5
Position
complement(1133163..1133873)
Genome map
AA seq 236 aa AA seqDB search
MGRAFEFRKGRKLKRWSAMAKTFTRIGKDIVMAVKEGGPNPEANARLRAVIQNAKAANMP
KDNVERAIKRATDKDTENYKEVIFEGYGPHGIAFLIECATDNNNRTVANIRSYFNKCNGT
LGTQGSVEFMFDHTCNFRIPAEEGRDLEEFELELIDFGIDEIFEDEDGVMIYAPFESFGS
IQKELEGRGIEILSSGFDRIPQVTKELSEEEIADVEKLLDKIEEDDDVQNVFTTMA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgggaagagcgtttgaatttagaaaaggacgtaagctaaaacgttggtctgctatggca
aaaacgtttacaagaattggtaaggatatcgtaatggctgtaaaagaaggtggacctaat
cccgaggctaatgctcgccttcgtgccgtaatacaaaatgctaaggcagctaatatgcct
aaagataacgtagagcgtgccattaaacgtgctactgataaagatactgaaaactataaa
gaagtaatattcgaaggatacgggcctcatggtatcgctttcttaatcgaatgtgctaca
gataataacaatagaactgttgccaacattagaagttacttcaataaatgcaacggtact
ttaggtacacaagggtctgttgagtttatgttcgaccatacatgtaacttcagaatccct
gctgaagaaggtagagatctagaagagttcgaattagaattaattgattttggtattgat
gaaatctttgaagatgaagatggtgtaatgatttacgctccttttgaaagcttcggatct
atccaaaaagagttagaaggtagaggaattgagatcttatcttctggattcgatagaata
ccacaagtaacaaaagaactttctgaagaagaaatagctgacgtagaaaagttattagac
aaaatcgaagaagatgacgacgtacaaaacgttttcacaactatggcataa

DBGET integrated database retrieval system