KEGG   Myroides profundi: MPR_1819Help
Entry
MPR_1819          CDS       T03631                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mpw  Myroides profundi
Pathway
mpw00260  Glycine, serine and threonine metabolism
mpw01100  Metabolic pathways
mpw01110  Biosynthesis of secondary metabolites
mpw01120  Microbial metabolism in diverse environments
mpw01130  Biosynthesis of antibiotics
mpw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MPR_1819
Enzymes [BR:mpw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     MPR_1819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AJH14999
UniProt: A0A0B5S0S4
Position
2051746..2052765
Genome map
AA seq 339 aa AA seqDB search
MYSFKNDYAEGMHPNILNRIIETNLIQQAGYGDDEYTLRAKELIQAKIENPQAQIYFVSG
GTQANLLVISSILRTHQAVIAPQTGHIFANETGAIEATGHKVIPVATTNGKLTAQDIERM
AGEYGLRPHVVEPKMVYISNSTELGTIYTKEELTAISSTCKQLGLYLFIDGARLGHALTA
DNNDLTLKDIADLTDVFYIGATKNGGLLGEAIVFNNTELATYFDYNLKQKGALLAKGRLL
GLQFETLFTDNLYFDLASHANRMATKLTEAFKAKGYHFLGDSTTNQLFPILPLALIEELN
KDYDFYIWKAIDQEYAAIRLITSWATDEEMVNQFIEKIK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtacagttttaaaaatgattatgcagaaggcatgcatcctaatatactaaatagaata
atagaaactaatctaatccaacaagctggatatggtgatgatgaatatacgctaagagca
aaagaactaatccaagctaaaatagagaatcctcaagcacagatctacttcgtatctgga
ggaactcaagctaacttattagttatttcttctatcctacgtacacatcaggcagttatt
gcgcctcagacagggcatatctttgcaaatgagacaggagccatagaagcgacagggcat
aaagtaatccctgtagcgactactaatggtaaactaaccgctcaagatatagaacgtatg
gcaggtgaatatggattaagacctcatgtagtagagcctaaaatggtgtatatttctaac
tctacagagctggggactatctatactaaggaagaactaacagccatctcttctacttgt
aagcagttagggttatacctttttatagatggagctagattaggacacgcattgacagct
gataataacgaccttaccttaaaagatattgctgatttaactgatgtattctatatagga
gcaactaaaaatggtggattattaggtgaggctattgtgtttaataatactgaattagct
acttattttgattataatttaaagcagaaaggtgctttactagccaagggaagattatta
ggattacaatttgaaactttgtttacagataatctctattttgacttagccagtcatgcc
aatagaatggctacaaaactaacagaagcatttaaagcaaaaggatatcatttcttagga
gattctactacgaatcagttatttcctattcttcctttagcactgatagaagagctgaat
aaagattatgacttctatatttggaaagcaatagatcaagaatatgctgctattagactg
attacgtcatgggctactgatgaagagatggtcaatcaatttatagagaagataaaataa

DBGET integrated database retrieval system