KEGG   Myroides profundi: MPR_2670Help
Entry
MPR_2670          CDS       T03631                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mpw  Myroides profundi
Pathway
mpw00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MPR_2670
Enzymes [BR:mpw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     MPR_2670
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     MPR_2670
    1.1.1.-  
     MPR_2670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 adh_short HI0933_like 2-Hacid_dh_C 3HCDH_N FAD_binding_3 FokI_C FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AJH15836
UniProt: A0A0B5RRX6
Position
complement(2995950..2997014)
Genome map
AA seq 354 aa AA seqDB search
MSTMKAARWYAAKDIRVEQTEIPTPAKGQVKVAVQYAGICGSDLHEYVHGPQLIPLDKPY
PLNGHQGVTTLGHEFSGIVEELGEGVKNIKVGDRVVIEPIYKNFDSPFVASGEYNLGEHL
GFIGLAGNGGFAKYVVVEDYMIHKIPDTMSFEQGALVEPAAVAVYSVLQSGLKVGQTVLV
SGAGPIGLLCAQAALAAGASTVIVTDVAEKRLEKAKEIGATHVFNAMEADLPAKIKALTG
GLGVNVFLDCAGVQASYNTGIASTRNGGTAVLVALFGKPVQHDALDQVLREITVKGVIAY
RNIFPEVINLIDSGRMEVEKLVTNKIGLDEIVTNGFEALVSNPEQVKILIDINR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaatgaaagcagcacgctggtatgcagccaaagatattagagtagaacaaaca
gaaatccctactccagctaaaggacaggtaaaagtagcagttcaatatgcaggtatctgt
ggatcagacttacacgaatatgtacacgggcctcaattaattccattagacaaaccttat
ccattaaatggtcatcaaggtgtaactactttaggacatgagttctcaggtatcgttgaa
gaattaggagaaggtgtaaaaaatattaaagtaggggatcgtgtagtaattgagcctatc
tataaaaacttcgatagcccattcgtagcttctggagaatacaacttaggagaacactta
ggtttcatcggattagcaggtaatggaggatttgctaaatacgtagtggtagaagattat
atgattcacaaaattcctgatacgatgtcttttgaacaaggtgctttagtagagcctgct
gcagtagctgtatactcagtactacagagtggtctaaaagtaggacagacagtattagta
tctggtgcaggacctatcgggctactatgtgctcaagcagctttagcagctggtgcgtct
actgtgatcgttacagatgtggcagagaaacgcttagagaaagcaaaagaaatcggagct
actcatgtattcaatgctatggaagctgatcttcctgctaagattaaagccttgactggt
ggtctaggagttaatgtattcttagactgtgctggtgtacaagcttcttataatacaggt
attgcttctactcgtaatggaggtactgctgtattagttgctttattcggaaaaccagtt
caacacgatgctttagatcaagtattaagagagattactgtaaaaggggttatcgcttat
agaaatatcttcccagaagtaattaacttaatcgactctggtcgtatggaggtagaaaaa
ctagtgacaaataaaattggtttagatgagattgtaacaaatggttttgaagccttagta
agcaatccagaacaagttaaaattcttattgatatcaatagatag

DBGET integrated database retrieval system