KEGG   Myroides profundi: MPR_3021Help
Entry
MPR_3021          CDS       T03631                                 

Definition
(GenBank) cytochrome c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
mpw  Myroides profundi
Brite
KEGG Orthology (KO) [BR:mpw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MPR_3021
Enzymes [BR:mpw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     MPR_3021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AJH16159
UniProt: A0A0B5S404
Position
complement(3380497..3381528)
Genome map
AA seq 343 aa AA seqDB search
MKKRLVLLTVLLALVSCKKEQKSNSDDKGEVKSELLTKASAYFQPISSVENTNLDPEKVA
LGKYLYFDTNLSKDGNISCNSCHNLNTYGVDNLAFSPGDDGSLGGRNSPTVFHAALHSMQ
FWDGRAKDVEEQAGGPILNPVEHNIKDEKELEDRLRKIDMYKEKFAAVYKSDKEPITFKN
ITNAIGAFERTLMPESRFDKFLDGDITALTAQEQKGLETFISVGCITCHNGVALGGQMFQ
KFGVYGDYWQETKSAKIDNGLADLSKKDTEKYLFKVPGLRNIEHTGPYFHDGSVKDLKEA
VRIMASLQTNVKLSQEQIDDITVFLGSLSSDIKDEVKKSPFES
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcgactagttttattgactgttttattggcattggtaagttgtaaaaaagag
caaaaaagtaattctgatgataaaggggaagtaaagtctgaattactaacaaaagcctca
gcttactttcaacctatctcttctgtagagaatacaaatttagatccagagaaagtagca
ttagggaaatatttatattttgatacaaatctatctaaggatggaaatatcagttgtaat
tcatgtcataatttaaatacttatggagtggataatttagcattctctcctggagatgat
ggatcattaggaggacgaaattctcctacagtgtttcacgcagccttgcacagtatgcag
ttttgggatggtagagcaaaagatgtagaagaacaagctggagggccaattctaaatcct
gtagaacacaatattaaagacgaaaaggaactagaagatagattgcgtaaaatagatatg
tataaggagaaatttgctgcagtatataaatcagataaagaacctattacatttaagaat
attacgaatgccattggtgcatttgagcgtacattaatgcctgaaagcagatttgacaaa
ttcttagatggggatataacggctttaactgcacaagaacaaaagggattagagactttt
atttctgtaggatgtattacttgtcataatggagtagcgctaggaggacagatgttccaa
aaattcggagtgtatggtgactattggcaagaaactaaatctgcgaagattgataatgga
ttagcagatttaagtaaaaaggatacagagaaatatttgtttaaagtacctgggttaaga
aatatagaacatacaggtccttattttcatgatggttctgtgaaagatctaaaagaggct
gtgcgtatcatggctagtctacaaacaaatgtaaaattaagccaagagcaaatagatgat
attacagtattcttaggaagtttgtctagtgatataaaagatgaggtaaaaaaatcacct
tttgagtcatag

DBGET integrated database retrieval system