KEGG   Melissococcus plutonius DAT561: MPD5_0996Help
Entry
MPD5_0996         CDS       T01763                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
mpx00010  Glycolysis / Gluconeogenesis
mpx00020  Citrate cycle (TCA cycle)
mpx00620  Pyruvate metabolism
mpx01100  Metabolic pathways
mpx01110  Biosynthesis of secondary metabolites
mpx01120  Microbial metabolism in diverse environments
mpx01130  Biosynthesis of antibiotics
mpx01200  Carbon metabolism
Module
mpx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPD5_0996
   00020 Citrate cycle (TCA cycle)
    MPD5_0996
   00620 Pyruvate metabolism
    MPD5_0996
Enzymes [BR:mpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MPD5_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: BAL62226
UniProt: H5T4Y3
Position
1:complement(1108785..1110413)
Genome map
AA seq 542 aa AA seqDB search
MTYQFKLPDIGEGISEGEIAKWFVKPGDTIKEDDTLLEVQNDKSVEEIPSPVTGTIKTIL
ISEGSVANVGDVLVEIDAPGHEEAGETTKVEAAESTVASDNSTFYQFKLPDIGEGISEGE
IAKWFVKPGDTIKEDDTLLEIQNDKSVEEIPSPVTGTVKTILVSEGSVANVGDVLVEIDA
PGHNATNVSSSNSTQSEKQDVNSNSVKNTEEKSVQSKTTSLSTNDSTKQVLAMPSVRQYA
REKEVDIKQVSPTGKGGRVTKADIDTFISGGGQENTATSQEITTQLETNQAEESTNQSAT
SMIATEMAQSETREKMTPTRKAIAKAMVHSKQTAPHVTLHDEVEVSKLWEHRKKFKTIAS
EYGTKLTFLPYVVKALTATVQKFPVLNASIDDATQEIVYKNYYNIGIATDTENGLYVPNI
KNANTKSMFAIAAEINEKAEAAQQGKLTAQDMKAGSITISNIGSVGGGWFTPVINYPEVA
ILGVGTITQQPIVNTEGELAVGRVLKLSLSFDHRIVDGATAQKAMNNIKRLLADPELLLM
EG
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaatttaaattaccagatattggagaaggaatttcagaaggcgaaattgca
aaatggtttgtcaaaccaggcgatactattaaagaagatgataccttactagaagttcaa
aatgataaatctgtagaagaaataccatcacctgttactggaacaattaaaactattttg
atatcggaaggatcggtagcaaatgttggtgacgttttggtagagattgatgcacctgga
catgaagaagcaggggaaacaacaaaagtagaagctgctgaatcaacagtagcttctgac
aattcaaccttttatcaattcaaattacccgacattggagaaggaatttcggaaggcgaa
attgcaaaatggtttgtcaaaccgggcgatactattaaagaagatgatactttactagaa
attcaaaatgataaatccgtagaagagataccatcacctgttactggaaccgtcaaaacg
atcttggtttctgaaggatcggtggcaaatgttggcgatgttctagtagaaattgatgca
ccgggtcataatgctactaatgtttcatcatcaaattcaacacaatcggaaaaacaggat
gttaatagtaactcggttaaaaatacggaagaaaaatcagttcaatctaaaacaacttcc
ttatcaacaaatgattcaactaaacaagtattagctatgccctctgttcgccagtatgca
cgtgaaaaagaggtagatattaagcaagtttcaccaactggaaaaggtggacgggtcact
aaagctgatattgatacttttatttcaggcggtggacaggaaaatacagcaacttcacaa
gaaataacaacacaactggaaacaaatcaagcagaagaaagtacaaatcagtcagctaca
tcaatgatagctactgaaatggctcaatctgaaactcgtgaaaaaatgacacctactaga
aaagcgattgccaaggcaatggttcatagtaaacaaacagctcctcacgttacattacac
gatgaagttgaagtatcaaaactttgggaacatcgtaagaaatttaaaaccattgcttct
gaatatggaacaaaattaactttcttgccctatgttgttaaagcactaacagctactgta
caaaaattccctgtattaaatgcttcaattgatgatgctacccaggaaattgtctataaa
aactattataatattggtattgcaactgacacagaaaatggattgtatgtaccaaatata
aaaaatgcgaatacaaaaagcatgtttgcaattgctgctgaaattaatgaaaaagcagaa
gcggcacaacaaggaaaattaactgctcaggatatgaaagcaggatcaattacgattagt
aatattggttctgtaggtggtggttggtttacaccggtcatcaattatccagaagttgct
attttgggtgttggtacaattacccaacaaccaattgtaaatacagaaggtgaacttgcc
gtaggtcgtgtattgaaactctccttaagctttgatcatcgaattgttgatggagcaaca
gcacaaaaggcaatgaacaatattaaacgcttattggctgatccagaattattattaatg
gaagggtga

DBGET integrated database retrieval system