KEGG   Melissococcus plutonius DAT561: MPD5_1008Help
Entry
MPD5_1008         CDS       T01763                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mpx  Melissococcus plutonius DAT561
Pathway
mpx00040  Pentose and glucuronate interconversions
mpx00052  Galactose metabolism
mpx00500  Starch and sucrose metabolism
mpx00520  Amino sugar and nucleotide sugar metabolism
mpx01100  Metabolic pathways
mpx01130  Biosynthesis of antibiotics
Module
mpx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mpx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MPD5_1008
   00052 Galactose metabolism
    MPD5_1008
   00500 Starch and sucrose metabolism
    MPD5_1008
   00520 Amino sugar and nucleotide sugar metabolism
    MPD5_1008
Enzymes [BR:mpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MPD5_1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: BAL62238
UniProt: H5T4Z5
Position
1:complement(1124995..1125903)
Genome map
AA seq 302 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKAIAKEMLPIVDKPTIQFIVEEALASGIEDILIVTGKAK
RPIEDHFDANFELESNLRQKNKTDLLKLVEETTDVNLHFIRQSHPMGLGHAVLQAKAFVG
NEPFIVMLGDDIMKDKIPLSKQLMNDYENTHASTIAVMKVPHMETSKYGIIDPEQEIAKG
LYNVHNFVEKPKPENAPSDLAIIGRYLLTPEIFEILETQKPGAGNEIQLTDAIDTLNRTQ
RVFAREFVGKRFDVGDKFGFLKTSIEYGLVHPEVKDNLRQFIIDTGIQLSKEDKTKKTDN
KS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagccgttattccagcagcagggttaggtacccgttttttacctgca
accaaagcaatcgctaaggaaatgttaccaattgttgacaaaccaacgattcaatttatt
gttgaggaagctttagcttcaggaattgaagatatcttaattgtaactggaaaagccaaa
cgaccaattgaagatcattttgatgcaaattttgagttagaaagtaatttacgacaaaaa
aataaaacagacctattaaaattggtggaagaaacgacagatgtaaacttacattttatt
cgtcaatctcatcctatgggactaggacatgctgtacttcaggcaaaggcttttgttgga
aatgagccatttattgttatgcttggtgatgacatcatgaaagataagataccattatca
aaacaactaatgaatgattatgaaaatacacacgcatcaacaattgctgttatgaaagtt
ccccatatggaaacttcaaaatatggaattattgatcctgaacaggaaattgctaaggga
ttatataatgttcataattttgttgaaaaaccaaaacctgaaaacgcacctagtgattta
gcaattattggtcgttatttactgacgcctgaaatatttgaaattttagaaacacaaaaa
cccggagctggaaatgaaattcagttaactgatgccattgatacattgaacagaacgcaa
cgtgtatttgccagagagtttgtgggtaaacgatttgatgttggtgataaatttggcttt
ttaaaaacaagtattgaatatggccttgttcatccagaagtaaaagataacttgcgtcaa
tttattatcgatacaggaattcaattatccaaagaagacaaaacaaaaaagacagataac
aaatcataa

DBGET integrated database retrieval system