KEGG   Methanolobus psychrophilus: Mpsy_0328Help
Entry
Mpsy_0328         CDS       T02280                                 

Definition
(GenBank) ribulose bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mpy  Methanolobus psychrophilus
Pathway
mpy00630  Glyoxylate and dicarboxylate metabolism
mpy01100  Metabolic pathways
mpy01110  Biosynthesis of secondary metabolites
mpy01120  Microbial metabolism in diverse environments
mpy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mpsy_0328
Enzymes [BR:mpy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Mpsy_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AFV22539
Position
complement(321502..322941)
Genome map
AA seq 479 aa AA seqDB search
MSLTEEQLVQSLNPKQQGYVDLKLADPRNGEYLLGVFHLVPEGRLNMLQTAAEVAAESST
GTNFKVNTETPFSKVMNALVYQLDLERDLVWIAYPWRLFDRGGNVQNILTYIVGNILGMK
EVKALKLMDVWFPPSMLEQYDGPSYTVDDMRKYLGVYNRPILGTIVKPKMGLTSAEYAEV
CYDFWVGGGDFVKNDEPQANQDFCPYDKMVKHVKEAMDKAVKETGKKKVHSFNVSAADFD
TMIKRCEMIVNAGFEPGSYAFLIDGITAGWMAVQTLRRRYPGVFIHFHRAGHGAFTRPEN
PLGFSVLVLSKFARLAGASGIHTGTAGVGKMKGTPQEDVVAANGILYLRSKGHFFDQSWS
KIPDLDKDVIALVNEDTAHHAILEDDSWRAMKKCCPIVSGGLNPIRLKPFIDVMGNVDFI
TTMGSGVHAHPGGTQGGAKALVQACEAYLKNMDIEQYAKDHEELAQAIEYFSKASKDAM
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgactgaagagcaattggtacaatcgctgaatcccaaacaacagggctatgtg
gatcttaagctggccgaccccaggaatggggaatatctacttggggtctttcatttagtt
ccggaaggaaggttaaatatgcttcagactgctgcggaagttgcagcagaatcatctacg
gggacaaatttcaaagtaaacaccgagacccctttttcaaaagtgatgaatgcccttgtt
taccagcttgatctggaaagggacctggtatggatagcctatccatggagactctttgac
agaggcggtaatgtccagaacatcctgacttatatagtagggaatatcctgggaatgaag
gaagttaaggccctgaaattaatggatgtatggttcccgccatcaatgcttgagcagtat
gacggtcccagttatactgttgatgatatgcgcaaatatcttggagtatataacaggccc
attcttggaactatcgtgaaaccaaagatgggactcacttctgcggaatacgctgaggtc
tgttatgatttctgggttggagggggagatttcgtcaagaacgacgagcctcaggcaaac
caggatttctgcccatatgacaagatggtgaaacatgtcaaggaagctatggacaaggca
gtaaaggaaaccgggaaaaagaaagtccactctttcaatgtctcagctgctgattttgac
accatgataaaaagatgtgagatgatcgtcaatgcaggctttgaacccggcagctatgca
ttcctgatagacgggataactgccggctggatggctgtccagactctcaggcgaagatat
ccgggtgttttcatccatttccacagggcaggccacggggctttcacaagacctgagaac
ccgctcggattctccgtactggtactgtccaaattcgcacgtcttgcaggtgcctccgga
atccataccggtacggcaggagttggcaagatgaaaggcacccctcaagaggatgttgtt
gccgcgaacggtatcctgtacctgaggtccaaagggcacttctttgatcagtcctggtca
aagataccggatctcgataaagatgtcatagctcttgtgaacgaggatacagctcaccat
gccatcctggaggatgacagctggagagctatgaagaaatgctgcccgatcgtttccggc
gggcttaatcccatcaggctgaaaccctttatcgatgtcatgggaaacgtggatttcatt
accactatgggatcaggcgtgcatgcccatcctggtggaactcaagggggagcaaaagcc
ctggtgcaggcatgtgaagcttatcttaagaacatggatattgagcaatatgccaaagat
catgaggaactggcgcaggccatcgaatatttctccaaggcctcaaaagatgcgatgtga

DBGET integrated database retrieval system