KEGG   Methanolobus psychrophilus: Mpsy_0486Help
Entry
Mpsy_0486         CDS       T02280                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mpy  Methanolobus psychrophilus
Pathway
mpy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mpy01100  Metabolic pathways
mpy01110  Biosynthesis of secondary metabolites
mpy01130  Biosynthesis of antibiotics
mpy01230  Biosynthesis of amino acids
Module
mpy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpsy_0486 (trpC)
Enzymes [BR:mpy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mpsy_0486 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG FMN_dh His_biosynth IMPDH DHO_dh Trp_syntA NanE
Motif
Other DBs
NCBI-ProteinID: AFV22697
UniProt: K4MB01
Position
481786..482577
Genome map
AA seq 263 aa AA seqDB search
MHSVIHEIIRSTEERVKLISYHHCNKYSSSEKRGIVASIQKKIDEGKVAVISEVKPASPR
RKLKDIPPGDAAAIARLMEEAGAVAISVLTEPQFFRGSLDNLLAVRESVSIPVLRKDFII
NEIQVEEVGSDMILLIVSVLGESVREMVTLVRSKGMEPLVEVHDLEELDIALSTDTRLIG
INNRDLSTLETDLEVTSRLAPLIRKYDAKNGTRHIIISESGISNAADVCKVIEAGADGIL
VGTSIIESDDVYAKTKELVEALR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcattctgttatccatgaaataatcagatcgactgaagaaagagtaaaacttatcagc
taccatcattgcaataaatactcatcttcagagaaaagaggtattgtggcatcaatccaa
aaaaagatagatgaagggaaagtagctgtgatatctgaggtgaagccggcatcaccccgc
aggaaactgaaagatataccccccggggacgcagctgcaatagccaggttgatggaagag
gctggtgctgtggcaatatccgtgctgacagagccgcaatttttcagggggtccctggat
aacctgctggctgtcagagagagtgtcagcattccggtgctgcgcaaggatttcatcatt
aatgagatacaggttgaagaagtaggatctgatatgatattactcatcgtgagcgtcctt
ggggaatcggttagggaaatggtcacgctggtccggagtaaaggaatggagccgctggtc
gaggtccatgatctggaagagcttgatatagccctgtcaacagatacccgcctgataggg
atcaataacagggacctgagcacacttgaaactgaccttgaagttacctcacgcctggca
ccgcttatccgtaagtacgatgccaagaacgggaccagacacatcattattagtgagagc
gggatcagcaatgcagccgatgtatgtaaagtgattgaggccggcgccgacgggatactt
gtcggcacgtccattatcgaaagtgacgatgtttatgcaaaaacgaaagagcttgttgaa
gcactcagatga

DBGET integrated database retrieval system