KEGG   Methanolobus psychrophilus: Mpsy_1638Help
Entry
Mpsy_1638         CDS       T02280                                 

Definition
(GenBank) hypothetical protein
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
mpy  Methanolobus psychrophilus
Pathway
mpy00072  Synthesis and degradation of ketone bodies
mpy00280  Valine, leucine and isoleucine degradation
mpy00650  Butanoate metabolism
mpy00900  Terpenoid backbone biosynthesis
mpy01100  Metabolic pathways
mpy01110  Biosynthesis of secondary metabolites
mpy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mpsy_1638
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Mpsy_1638
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mpsy_1638
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mpsy_1638
Enzymes [BR:mpy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     Mpsy_1638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III_C HMG_CoA_synt_N HMG_CoA_synt_C Thiolase_N WYL_3 ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFV23845
UniProt: K4MD03
Position
1612440..1613489
Genome map
AA seq 349 aa AA seqDB search
MSVGIVSYGAYIPRYRIKIDDIARVWGDDAEILKAGLMVFEKSFPDVDEDTATMAVEAAR
SAVNRACLDAQRIGAVYTGSESHPYAVKPTSTIVAEAVGATPVLTAADFEFACKAGTAAI
QACMGLVSSGMIDLGLAIGADVAQGAPGDALEYTAAAGGVAYVIGNKESELAAIIEDTYS
FTTDTPDFWRREGMPYPEHGGRFTGEPGYFKHVTNAAKGLMEKIGTKPDDYDFAVFHQPN
GKFPSRAASMLGFSKEQIKPGLVVPRLGNTYSGSCMMGIAATLDQAKPGDRIFATAFGSG
AGGDAFSITVTDRIEEIRNNAPKVEELLANPIYADYAKYARHKGKIRLA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtagggatagtctcatacggtgcctatatacctcgatataggattaaaatagac
gacatcgcccgtgtatggggagacgatgcggaaatattaaaagcaggattaatggtattt
gaaaaatcatttcccgatgtggatgaagatacagctaccatggcagtagaagctgcaagg
tcggctgtaaacagagcatgcctcgatgcacagaggattggtgcagtgtataccggctca
gagagccacccatacgctgtgaagcccacaagtacaatagttgccgaggcagtgggtgct
acacctgtgctgacagctgcagattttgagtttgcctgtaaagcaggtacggctgctatc
caggcatgcatgggtcttgtttcctccggcatgatagaccttggcctggcgatcggtgcg
gatgtcgcccagggagcacccggagatgcactggaatatactgcagccgcaggcggcgtg
gcctatgttataggcaacaaggaatcggaacttgcagcaataatagaagatacatactcg
ttcacaacggacactcctgacttctggaggcgtgaaggcatgccatatccggaacatgga
ggacgcttcacaggcgaacccggttacttcaaacatgtcaccaatgctgcaaaaggactc
atggaaaaaataggtacaaaacctgatgactatgattttgctgtgttccaccagccaaac
gggaaattcccttcacgtgcagcctcaatgcttggattcagtaaggaacagatcaagcct
ggccttgtggtcccaagactcgggaacacttattcaggctcctgcatgatgggaatagca
gcaacactggaccaggcaaaaccaggagatcgcatatttgcaaccgctttcggttccggt
gcaggcggagacgccttcagcataacggtcaccgacaggatagaagagatccgcaataat
gcacccaaggtagaagagcttcttgcaaatccgatatatgcggattatgcgaagtatgca
aggcataaaggaaagataaggttagcgtga

DBGET integrated database retrieval system