KEGG   Methanolobus psychrophilus: Mpsy_2102Help
Entry
Mpsy_2102         CDS       T02280                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
mpy  Methanolobus psychrophilus
Pathway
mpy00130  Ubiquinone and other terpenoid-quinone biosynthesis
mpy00627  Aminobenzoate degradation
mpy01100  Metabolic pathways
mpy01110  Biosynthesis of secondary metabolites
mpy01120  Microbial metabolism in diverse environments
mpy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mpy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Mpsy_2102
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Mpsy_2102
Enzymes [BR:mpy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     Mpsy_2102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AFV24308
UniProt: K4MDW7
Position
complement(2037510..2038061)
Genome map
AA seq 183 aa AA seqDB search
MEIVIGISGASGSIYGIRLLEILSKMDIVTHLVITKTAKQIIEIETDYSVIEIEDLASHV
YGEGELTAPIASGSHRFAGMLVAPCSMKTLGEIACGMSNNLLGRAADVCLKERRRLVLMP
RETPFNQIHLENMLKLERAGAIILPACPGFYSRPQTIDDLVNSMAGRALDLMGIDNEVYK
RWR
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggaaatagtcattggtatcagcggtgcatcaggttccatatacggaataaggttattg
gagatcctttctaaaatggatattgtaacccaccttgtcataactaagaccgcaaagcag
ataatagagattgaaactgattattctgtcattgagatagaagacctggcaagccacgta
tatggggaaggagagcttacagcgcctattgcaagtggatctcaccggttcgccgggatg
ctggtcgccccctgcagcatgaaaacgctgggtgagatcgcctgtggcatgtccaataac
ctgctggggcgcgcggcggatgtgtgcctgaaagagaggagaaggcttgtcctgatgccc
agagagacgccattcaaccagatacacctggaaaacatgctcaaactcgaacgggcaggc
gcaataatactgcctgcatgccccggtttctactccaggccgcagacaatagacgatctg
gtcaattccatggcaggcagggcactggacctcatgggcatcgataacgaagtgtacaaa
cgctggagataa

DBGET integrated database retrieval system