KEGG   Methanolobus psychrophilus: Mpsy_2187Help
Entry
Mpsy_2187         CDS       T02280                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase subunit C
  KO
K00579  tetrahydromethanopterin S-methyltransferase subunit C [EC:2.1.1.86]
Organism
mpy  Methanolobus psychrophilus
Pathway
mpy00680  Methane metabolism
mpy01100  Metabolic pathways
mpy01120  Microbial metabolism in diverse environments
mpy01200  Carbon metabolism
Module
mpy_M00357  Methanogenesis, acetate => methane
mpy_M00567  Methanogenesis, CO2 => methane
mpy_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mpy00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mpsy_2187
Enzymes [BR:mpy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Mpsy_2187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrC
Motif
Other DBs
NCBI-ProteinID: AFV24391
UniProt: K4MRD2
Position
complement(2111609..2112454)
Genome map
AA seq 281 aa AA seqDB search
MSAGGGGGGAHAAIPQNNIIAFGIVGGLLGIYGAYFLVDMVGPYMSFLGALGAICGIVWG
AAAVRRVANYGLGTGVPSIGMLALGIGIIASTFGLAVGGIAGPVVALVFASLIGLVVGIL
ANKVLNMGIPIMVQSMTEIAAAGAITIVGLSTSMIGTFMFFDEVVNGVVVAQGVASGVMT
TGYIAVIFIAGGLAILHPYNANLGPDEKQDRTLACAFEKGAIAMIIAGIVATITPFASGS
LTILIGVAIWYVSFSGFYKLVKRDAYMVTGAGLLPSKEELE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaggcggaggaggcggaggagcccatgcggcaattccccagaataacataatc
gccttcggaatagtaggaggccttttaggaatatatggagcgtatttccttgttgacatg
gtaggaccctacatgtcattcttaggtgcccttggtgcaatatgcggtattgtatggggc
gctgcagcagtcaggcgagtcgcaaattacggcctgggtaccggagtaccttcaataggc
atgctcgctcttggtattggtataattgcatcaacattcggacttgctgttggcggaata
gccggacctgtggtcgcactggtctttgcttccctgataggactagtagtaggtattcta
gcaaacaaggtactcaacatgggcattcccatcatggtgcagtccatgaccgaaattgca
gcagcgggtgccataaccattgtcggcctcagcacttctatgatcgggacattcatgttc
tttgacgaggtagtcaacggcgtggtcgtcgcccagggagtcgcaagcggagtcatgaca
actggatacatagcagttatcttcattgcaggcggtcttgcaattctgcacccctacaat
gcaaacctcggacctgatgagaaacaggaccgtacacttgcatgtgcttttgagaaaggt
gctattgcaatgataattgcaggaatagtcgctactattaccccgtttgcgtccgggtcc
cttacaatccttataggagtcgctatatggtacgtttcctttagcgggttctacaagctt
gtaaagagagatgcatatatggtaacaggtgcagggcttctcccttctaaggaggaactg
gaatga

DBGET integrated database retrieval system