KEGG   Methanolobus psychrophilus: Mpsy_2354Help
Entry
Mpsy_2354         CDS       T02280                                 

Definition
(GenBank) 3-isopropylmalate dehydratase, small subunit
  KO
K16793  methanogen homoaconitase small subunit [EC:4.2.1.114]
Organism
mpy  Methanolobus psychrophilus
Pathway
mpy00300  Lysine biosynthesis
mpy00680  Methane metabolism
mpy01100  Metabolic pathways
mpy01120  Microbial metabolism in diverse environments
mpy01130  Biosynthesis of antibiotics
mpy01210  2-Oxocarboxylic acid metabolism
mpy01230  Biosynthesis of amino acids
Module
mpy_M00608  2-Oxocarboxylic acid chain extension, 2-oxoglutarate => 2-oxoadipate => 2-oxopimelate => 2-oxosuberate
Brite
KEGG Orthology (KO) [BR:mpy00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mpsy_2354
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Mpsy_2354
Enzymes [BR:mpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     Mpsy_2354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_C Aconitase_2_N
Motif
Other DBs
NCBI-ProteinID: AFV24558
UniProt: K4MEP0
Position
complement(2270027..2270512)
Genome map
AA seq 161 aa AA seqDB search
MDSIIKGRVWIFGNDIDTDVIIPGKYLRTTDMQVFADHAMEGIDPEFPRKVSKGDIIVAG
DNFGCGSSREQAPLALKHAGVSCVVARYFARIFFRNAINVGLPLIEVDVECNEGDEMEIN
LLEGTVRVNGRTCHGNKLPAFLLEILTDGGLVAHRKAAAKE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
ttggacagcataatcaaaggaagagtatggattttcgggaacgatatcgatacggatgtc
atcatacccgggaaataccttcgtacaacggacatgcaggtgtttgctgaccatgcgatg
gaaggcattgaccccgagttcccccgcaaggtcagcaaaggtgacataatagttgcagga
gataacttcggctgcggttcttccagggagcaggcgccccttgcacttaaacatgcaggc
gtttcctgcgttgttgccaggtattttgccaggatcttcttcaggaacgctataaatgtg
gggcttcctttgatagaggtggatgttgagtgcaatgaaggggacgagatggagataaac
ctccttgaaggcactgtcagggtcaacggaaggacctgtcatggaaacaaactaccggcc
ttcctgctggaaatactgaccgatggcggacttgtggcgcacaggaaagctgcggcaaaa
gaatga

DBGET integrated database retrieval system