KEGG   Marinitoga piezophila: Marpi_1372Help
Entry
Marpi_1372        CDS       T01665                                 

Definition
(GenBank) putative metal-dependent phosphoesterase, PHP family
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
mpz  Marinitoga piezophila
Brite
KEGG Orthology (KO) [BR:mpz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Marpi_1372
Enzymes [BR:mpz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Marpi_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AEX85772
UniProt: H2J3F6
Position
complement(1423933..1424757)
Genome map
AA seq 274 aa AA seqDB search
MLLDLHSHSTYSDGTYKPEDLILLAKEKNLELYSITDHDNIDAQKEAIEFAKKYDVNYIT
GVEISCKFKNMFDLLGYGIDINNEKLISTLNRIQDYRKNRNNLMIERLKELGFEITLDEV
AEEAQGDVIGRPHFARVLLKKGYVKDREEAFDKYLGDGKLAYIPKQKLQPEEAVSLIKQA
GGYPVIAHPKYLKLSPSKLIDLIYYLKPFGLWGIEVYYSKHTRKEIEIFKDIALKTGLMI
TAGSDFHGENKPEIDLGMSVEDEYLKKSIDVLKG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcttttagacttacattcacattcaacatattcagacggaacatacaaaccagaagat
ctaatattattggctaaagaaaaaaatttagaattatattctataacagaccacgataat
atagatgcacaaaaagaagctattgaatttgcaaaaaaatatgatgtaaattatattact
ggcgtagaaatcagttgcaaatttaaaaatatgtttgatcttttgggatatggcattgac
ataaataacgaaaaattaatatccacacttaatagaattcaggattatagaaaaaataga
aataatttaatgatagaacgactcaaagaacttggttttgaaataaccttagatgaagtt
gccgaagaagctcagggagatgttattggtcgaccacattttgcacgtgttctgttaaaa
aaaggatatgtcaaagatagagaagaagcttttgataaatatcttggagacggaaaactt
gcatatattccaaaacaaaaattacaaccagaagaagctgtttctttaataaaacaggct
gggggttatcctgtaattgctcatccaaagtatttaaaattatctccatcgaaacttata
gatttaatatactatttaaaaccttttggattatggggtattgaagtttattattccaaa
catacaagaaaagaaattgaaattttcaaggatattgctttaaaaacaggattaatgata
acagcaggaagtgatttccacggagaaaacaaacctgaaattgaccttggaatgagcgtg
gaagatgaatacctaaaaaaatctatagatgtattaaaagggtga

DBGET integrated database retrieval system