KEGG   Marinitoga piezophila: Marpi_1536
Entry
Marpi_1536        CDS       T01665                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
mpz  Marinitoga piezophila
Pathway
mpz00472  D-Arginine and D-ornithine metabolism
mpz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Marpi_1536
Enzymes [BR:mpz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Marpi_1536
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: AEX85930
UniProt: H2J4I8
Position
1613036..1613407
AA seq 123 aa
MEPRKSDFEERAKHLMNMSDEELDKYFWDLVEKVVDPLIELASTHTSPSVERSVLLRMGF
NSMEAKALVDKFFEKNILGKGAGNIVYTIAKEHNIDYIQAGRDLIAGKYWDDVDRIFIHG
GDK
NT seq 372 nt   +upstreamnt  +downstreamnt
atggaaccaagaaaatcagattttgaagaaagagcaaaacatttaatgaatatgtccgat
gaggaattagataaatatttctgggatcttgttgaaaaagtagtagatcctctaattgaa
ttagcttcaacacatacatcaccatctgttgaaagatctgtattattgagaatgggtttt
aacagtatggaagcaaaagcattagttgataaattctttgaaaagaatatacttggcaaa
ggtgctggaaatattgtatatacaatagccaaagaacataatattgattatatacaggca
ggaagagacttaattgcaggaaaatactgggacgatgtggatagaatttttattcatgga
ggcgataaatga

DBGET integrated database retrieval system