KEGG   Marinitoga piezophila: Marpi_1537
Entry
Marpi_1537        CDS       T01665                                 

Definition
(GenBank) putative cobalamin binding protein
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
mpz  Marinitoga piezophila
Pathway
mpz00472  D-Arginine and D-ornithine metabolism
mpz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Marpi_1537
Enzymes [BR:mpz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Marpi_1537
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AEX85931
UniProt: H2J4I9
Position
1613404..1615602
AA seq 732 aa
MMKLEPNKKLNVEEILKDLDKYRPKRKGWTWRKKLPPRTKIGEFEYYEVSEPLKNFVALP
AAHYFNNIDPQPQEVITSEIASGRFEEDIRRMRMAAWHGADHIMVIRTLGQSHMDGLIEG
TPEGIGGIPITRKQLRASRKALDLIEEEVGRPINFHSYVSGVAGPEVAVLFAEEGVNGAH
QDPQYNVLYRGINMIRSFVDAAVAKKIMASVDMLQIDGAHNANASAKFAWKVMPELLVQH
AINSLYSVKAGMKKENIALSTVPPIVSPTPEFRLNFVYAITIRELFKDYKFRAQMNTRYI
ESDLFDATRIHVLDTLISRLTKADIQSTITPDEGRNVPWHINSIRGVETAKHTLIALDGI
KEMVQINWDNVRDKVRELKMRAILMLEEIIEMGGYFEAVENGMFVDNGEYPERMGDGIVR
KKDGGIGAGSVVPRDKDYMAPVCHHFGYNNLPEGLEKPCDLIGGCTLCNPDKIQYIDELD
EEDNVYKRLEKIREYRENNLIKPEVEWSYDGYIQLDMTIPESPEYAEAAALEICKRMGLE
DAQVIAKTVLHPTEGTYLELKAKVPFAIKKDELVLPKKAEVMSDDELFEFFAKNKVKVVA
GTVGNDEHNVGIREILDIKHGGIEKYGIKYEYLGTSVPPEKLIDAAIEFGAQAVLASMIV
THNDVHVENMKKLHQLAIEKGVRDKLLLIVGGTQLNDDLAKENGMDAGFGRGTKGAHVAT
FIAKKLKEKMEE
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgatgaaattagagcctaacaaaaaattaaatgtagaagaaatcttaaaggatttagat
aaatacagaccaaaaagaaaaggttggacatggagaaaaaaattacctccaagaaccaaa
ataggagaatttgaatattatgaagtaagcgaacctctaaaaaactttgttgcattacca
gcagcacattatttcaacaatattgatccacaaccacaggaagtaattacatcagaaatt
gcttcaggtagatttgaagaagatataagaagaatgagaatggccgcatggcatggtgca
gaccatattatggttattagaacattaggtcaaagtcatatggacggtttaattgaagga
acaccagagggtattggtggtataccaattacaagaaagcaattaagagcttcaagaaag
gctcttgacttaatagaagaagaagtgggtagacctataaacttccacagttatgtttct
ggtgttgcaggtccggaagttgctgtattatttgctgaagaaggtgtaaacggagctcat
caggatccacaatacaacgtattatacagaggcattaatatgatcagatcatttgttgat
gctgctgttgcaaaaaagattatggcatcggttgatatgcttcaaattgacggagctcac
aatgcaaatgcatcagcaaaatttgcatggaaggttatgccagaattgttggtacaacat
gcaattaactcattatactcagtaaaggctggaatgaaaaaagaaaatatcgctttatcc
acagttccgccaatagtttcaccaacaccagaatttagattaaacttcgtatatgcaata
acaataagggaattattcaaagattataaatttagggcacaaatgaatacaagatatata
gaatccgatctctttgacgcaacaagaatacacgtattggatacattaatttccagatta
acaaaggcagatatacaatcaacaattacaccagatgaaggaagaaacgttccatggcac
attaactctatccgtggtgtagaaactgcaaaacacacattaattgctttagacggcatt
aaagaaatggttcagattaactgggataatgtaagagacaaagttagagaattaaagatg
agagctatattaatgctcgaagaaataattgaaatgggcggatactttgaagctgttgaa
aatggaatgttcgttgacaatggcgaatatccagaaagaatgggcgatggtattgtaaga
aagaaagatggaggaattggagcaggttctgttgttccaagagacaaagactacatggca
cctgtatgtcaccactttggttataacaaccttccagaaggtcttgaaaagccatgtgac
ttaattggtggatgtacattatgtaatcctgataagatccaatacatagacgaacttgat
gaagaggataatgtatataagagacttgaaaaaataagggaatacagagaaaataactta
atcaaaccagaagtagaatggagttatgacggttacattcagcttgatatgacaattcct
gaatcaccagaatatgcagaagcagccgctcttgaaatctgtaagagaatgggacttgaa
gacgcacaggttattgcaaaaacagttcttcacccaacagaaggaacatatcttgagtta
aaggcaaaagtaccatttgctattaagaaggacgaacttgtattgcctaaaaaagcagaa
gtaatgtcagatgatgaattatttgaattctttgctaaaaacaaggtaaaggttgtagct
ggtacagttggtaatgatgaacacaatgttggtatcagggaaattctcgatattaaacat
ggcggtatagaaaaatacggtataaaatatgaatatcttggaacaagtgttccaccagaa
aaattaatagatgctgcaattgaatttggcgcacaggctgtacttgcttcaatgattgtt
acacataatgatgtacatgttgaaaacatgaaaaaattgcatcaattagcaatagaaaaa
ggtgtaagggataaattgttattaatagttggaggaacacagctaaatgacgatttagca
aaagaaaatggaatggacgcaggatttggaagaggaacaaaaggagctcatgttgcaaca
ttcattgcaaagaaattaaaagaaaaaatggaagaataa

DBGET integrated database retrieval system