KEGG   Mycobacterium tuberculosis H37Ra: MRA_0867Help
Entry
MRA_0867          CDS       T00540                                 

Gene name
fadA
Definition
(GenBank) acyl-CoA thiolase FadA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
mra00071  Fatty acid degradation
mra00072  Synthesis and degradation of ketone bodies
mra00280  Valine, leucine and isoleucine degradation
mra00310  Lysine degradation
mra00362  Benzoate degradation
mra00380  Tryptophan metabolism
mra00620  Pyruvate metabolism
mra00630  Glyoxylate and dicarboxylate metabolism
mra00640  Propanoate metabolism
mra00650  Butanoate metabolism
mra00900  Terpenoid backbone biosynthesis
mra01100  Metabolic pathways
mra01110  Biosynthesis of secondary metabolites
mra01120  Microbial metabolism in diverse environments
mra01130  Biosynthesis of antibiotics
mra01200  Carbon metabolism
mra01212  Fatty acid metabolism
mra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MRA_0867 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    MRA_0867 (fadA)
   00640 Propanoate metabolism
    MRA_0867 (fadA)
   00650 Butanoate metabolism
    MRA_0867 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MRA_0867 (fadA)
   00072 Synthesis and degradation of ketone bodies
    MRA_0867 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRA_0867 (fadA)
   00310 Lysine degradation
    MRA_0867 (fadA)
   00380 Tryptophan metabolism
    MRA_0867 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MRA_0867 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRA_0867 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MRA_0867 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mra04147]
    MRA_0867 (fadA)
Enzymes [BR:mra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MRA_0867 (fadA)
Exosome [BR:mra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MRA_0867 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABQ72597
UniProt: A5U0P7
Structure
PDB: 

Position
956383..957594
Genome map
AA seq 403 aa AA seqDB search
MSEEAFIYEAIRTPRGKQKNGSLHEVKPLSLVVGLIDELRKRHPDLDENLISDVILGCVS
PVGDQGGDIARAAVLASGMPVTSGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVE
SMSRVPMGSDGGAMGLDPATNYDVMFVPQSIGADLIATIEGFSREDVDAYALRSQQKAAE
AWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTTKEGLAKLKPAFEGLAALGGFDDVALQ
KYHWVEKINHVHTGGNSSGIVDGAALVMIGSAAAGKLQGLTPRARIVATATSGADPVIML
TGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHP
LGATGAMILGTMVDELERRNARRALITLCIGGGMGVATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagaagccttcatctacgaggccatccgcaccccgcgcggcaaacaaaagaac
ggatcgttgcacgaagtcaagccattgagcctggtcgtcggcctgatcgacgagctgcgc
aagcgccatcccgacctcgacgagaacctgatcagcgacgtcatcttgggctgcgtctca
ccggtgggcgaccagggcggcgacatcgcccgcgccgcagtgctggcatcgggcatgccg
gtcacctccggcggtgtgcagctcaaccggttctgcgcgtccggcctggaggccgtcaac
accgccgcgcagaaggtgcgttcgggctgggatgacctggtgctggccggcggcgtggag
tcgatgagccgggtgccgatgggctccgacggcggcgctatgggcctggacccggcgacc
aactacgacgtcatgttcgtcccgcagagcatcggcgccgacctgatcgccaccatcgag
ggcttctcccgcgaagacgtcgacgcctacgcgctacgcagccagcaaaaggccgccgag
gcgtggtcgggcggctacttcgccaagtcggtggtgccggtgcgcgaccagaacggcctg
ctgatcctcgatcatgacgaacacatgcggccggacaccaccaaggagggtctggccaag
ctgaagccggccttcgaaggcctggccgcgctgggcggtttcgacgacgtggcgctgcag
aagtaccactgggtggaaaagatcaaccacgtacacaccggcggcaacagctcggggatc
gtcgacggtgccgcgctggtgatgatcggttccgcggccgccggcaagttgcagggcctg
actccgcgggcgcgcatcgtcgccaccgccaccagcggcgccgacccggtgatcatgctc
accggccccaccccggccacccgcaaggtgctcgaccgcgccgggctgaccgtcgacgac
atcgacctgttcgagctcaacgaggcgttcgcgtcggtggtgctgaagttccagaaggac
ctcaacattcccgacgagaagctcaacgtcaacggtggcgccatcgcgatgggccacccg
ctgggtgccaccggcgcgatgatcctgggcaccatggtcgacgaactggagcgccgcaac
gcccgacgtgcactcatcacgctgtgcatcgggggcggcatgggtgtcgcgacgatcatc
gagagggtttaa

DBGET integrated database retrieval system