KEGG   Mycobacterium tuberculosis H37Ra: MRA_1878Help
Entry
MRA_1878          CDS       T00540                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
mra00071  Fatty acid degradation
mra00072  Synthesis and degradation of ketone bodies
mra00280  Valine, leucine and isoleucine degradation
mra00310  Lysine degradation
mra00362  Benzoate degradation
mra00380  Tryptophan metabolism
mra00620  Pyruvate metabolism
mra00630  Glyoxylate and dicarboxylate metabolism
mra00640  Propanoate metabolism
mra00650  Butanoate metabolism
mra00900  Terpenoid backbone biosynthesis
mra01100  Metabolic pathways
mra01110  Biosynthesis of secondary metabolites
mra01120  Microbial metabolism in diverse environments
mra01130  Biosynthesis of antibiotics
mra01200  Carbon metabolism
mra01212  Fatty acid metabolism
mra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MRA_1878
   00630 Glyoxylate and dicarboxylate metabolism
    MRA_1878
   00640 Propanoate metabolism
    MRA_1878
   00650 Butanoate metabolism
    MRA_1878
  Lipid metabolism
   00071 Fatty acid degradation
    MRA_1878
   00072 Synthesis and degradation of ketone bodies
    MRA_1878
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRA_1878
   00310 Lysine degradation
    MRA_1878
   00380 Tryptophan metabolism
    MRA_1878
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MRA_1878
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRA_1878
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MRA_1878
Enzymes [BR:mra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MRA_1878
Exosome [BR:mra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MRA_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ABQ73634
UniProt: A5U3N4
Position
2125696..2127180
Genome map
AA seq 494 aa AA seqDB search
MPVDPRTPVLIGYGQVNHRGDIDAEKQSIEPVDLMAAAARKAADSTVLEAVDSIRVVHML
SAHYRNPGQLLGERIKARTFTTGYSGVGGNMPQSLVNRACLDIQRGRAGVVLLAGAETWR
TRTGLRAKGSKLEWTVQDESVPLPDMAGDDVPMAGAAELRINLDRPAYVYPIFEQALRIA
YGESIENHRKRIGELWARFSAVAADNPHAWIRNPVTADEIWQPGPQNRMVSWPYTKLMNS
NNMVDQGAALLLTSVERATRLRIPAERWVYPQAGTDAHDTPAVADRHRLHRSTAIRIAGA
RALELAGLGLDDIEYVDLYSCFPSAVQVAAIELGLDTDDPARPLTVTGGLTFAGGPWSNY
VTHSIATMAELLAANPGRRGLITANGGYLTKHSFGVYGTEPPSEFRWEDMQPAVDREPTG
DGLVEWEGIGTVEAWTTPVNRDGQPEKAFLAVRTPDGSRSLAVITDPASVQATVREDIAG
VKVAVAPDGTATLR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccggtagaccccaggacgccagtgctgatcggctatggacaggtcaaccaccgaggc
gacatcgacgccgagaagcagtccatcgaacccgtcgacctgatggccgccgcggcccgg
aaagccgcggattcgacggtgctcgaggcggtggattcgatccgtgtggtgcacatgctg
tcggcgcattaccggaatcccgggcagctcctcggcgaacgaatcaaggcgaggaccttc
accaccggttacagcggggtgggcggcaacatgccgcaatccctggtcaaccgggcatgc
ctggacatccagcgcgggcgggccggcgtggtgctgctggctggcgccgaaacctggcgc
acccgaacgggcctgcgcgccaagggcagcaaactggagtggactgtgcaggacgaatcc
gttccgctgccggacatggccggcgacgacgttccgatggccggtgcggctgagctgcgg
atcaacctggaccggccggcctacgtgtacccgatattcgagcaggcgctgcgcatcgcc
tacggcgagtcgatcgagaaccaccgaaagcggatcggcgagctgtgggcgcggttcagt
gccgtagctgctgacaacccgcacgcgtggatccgcaacccggttacggctgacgagatc
tggcagcccggcccacagaaccggatggtcagctggccctacaccaagcttatgaactcc
aacaacatggttgaccagggtgccgcgctgctgctgacgtcggtcgaacgtgcgacacgt
ctgcgaataccggccgaacgctgggtttatccacaggctggcaccgacgcccacgacaca
ccggccgtcgccgaccgccaccgactgcatcggtcgacggccattcggatcgccggtgcc
cgggcgctggaactggctgggctggggctcgatgacatcgaatacgtcgacctgtattcg
tgctttccctccgctgtccaagtcgccgcaatcgaactcggcctggacaccgacgatcct
gcccgcccgctgaccgtcaccgggggcctgaccttcgccggcgggccgtggagcaattac
gtcacgcactccatcgccaccatggctgaactgctggcggccaatcccgggcgccgaggc
ctgatcaccgccaacggcggttacctgaccaaacacagtttcggggtctacggcaccgag
ccgccgtcggaattccgctgggaggacatgcaacccgcggtcgatagggagcccaccgga
gatgggttggtcgagtgggaaggcatcggcaccgtcgaagcgtggaccacaccagtcaac
cgggacggacaacccgagaaggcgttcctggcggtgcgcacgcccgacgggtcgcgcagc
ttggccgtgatcaccgatcccgcatcggtgcaagcaacggtgcgcgaggacatcgccggc
gtcaaggttgccgtcgcccccgacggcaccgcgaccctgcgatag

DBGET integrated database retrieval system