KEGG   Mycobacterium tuberculosis H37Ra: MRA_2521Help
Entry
MRA_2521          CDS       T00540                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide S-acetyltransferase E2 component PdhC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
mra00010  Glycolysis / Gluconeogenesis
mra00020  Citrate cycle (TCA cycle)
mra00620  Pyruvate metabolism
mra01100  Metabolic pathways
mra01110  Biosynthesis of secondary metabolites
mra01120  Microbial metabolism in diverse environments
mra01130  Biosynthesis of antibiotics
mra01200  Carbon metabolism
Module
mra_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MRA_2521 (pdhC)
   00020 Citrate cycle (TCA cycle)
    MRA_2521 (pdhC)
   00620 Pyruvate metabolism
    MRA_2521 (pdhC)
Enzymes [BR:mra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MRA_2521 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 Ribosomal_L13
Motif
Other DBs
NCBI-ProteinID: ABQ74292
UniProt: A5U5J2
Structure
PDB: 

Position
complement(2820726..2821907)
Genome map
AA seq 393 aa AA seqDB search
MSGEDSIRSFPVPDLGEGLQEVTVTCWSVAVGDDVEINQTLCSVETAKAEVEIPSPYAGR
IVELGGAEGDVLKVGAELVRIDTGPTAVAQPNGEGAVPTLVGYGADAAIETSRRTSRPLA
APVVRKLAKELAVDLAALQRGSGAGGVITRADVLAAARGGVGAGPDVRPVHGVHARMAEK
MTLSHKEIPTAKASVEVICAELLRLRDRFVSAAPEITPFALTLRLLVIALKHNVILNSTW
VDSGEGPQVHVHRGVHLGFGAATERGLLVPVVTDAQDKNTRELASRVAELITGAREGTLT
PAELRGSTFTVSNFGALGVDDGVPVINHPEAAILGLGAIKPRPVVVGGEVVARPTMTLTC
VFDHRVVDGAQVAQFMCELRDLIESPETALLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgaggacagcatcaggtctttcccggtgcccgacctcggcgagggactgcag
gaagtgacggtgacgtgttggagcgtcgccgtcggcgacgatgtggagatcaaccagacg
ctgtgttcggtggagaccgccaaggccgaggtcgaaatccccagcccgtatgccggccgg
atcgtcgagttaggcggcgccgaaggcgatgtgctcaaagtgggcgcggagctagttcgg
atcgacaccgggcccacggcagttgcgcagcctaacggtgaaggagcggtccccacgttg
gtcggctacggtgccgacgccgcgatcgaaaccagtagacggacaagccggccgctggcg
gcaccggtagtgcgcaagctggccaaagagttggcggtcgacctggccgcattgcagcgt
gggtcgggcgccggcggtgtgatcacccgggccgatgtgctggccgctgctcgaggcggc
gtcggagccgggccggacgtgcggccggtccacggcgtgcacgcgcggatggccgaaaaa
atgacgttgtcccacaaggagattccgaccgcaaaggccagcgttgaggtaatttgcgcc
gaactgctgcggctgcgcgaccggttcgtttcggcggcgcccgagattacaccgttcgcg
ctgacgctgcggctgctggttattgcattgaaacacaacgtaattctcaactcgacgtgg
gtcgactcgggcgaaggcccgcaagtacacgtgcatcgcggtgtgcatctggggttcggc
gcggccactgagcgtggattgctggtgccggtggtgaccgacgcccaggacaagaacacc
cgcgaacttgcctcccgcgtagcggaattaatcaccggcgcacgtgaaggcactctcaca
cccgcggagctgcgcggttcgacgttcacggtgtcgaacttcggggcgctgggagtcgac
gacggcgtgccggtgatcaaccatcccgaagcggcgatcctgggtctgggggcgatcaag
ccgcgcccggtggtcgtcggcggcgaggttgtcgcacggccgacgatgacgttgacttgt
gtgttcgaccaccgcgttgtcgatggtgctcaggtggcccagttcatgtgtgagctgcgg
gatctgatcgagtcgccggagaccgcgctgttggatctgtag

DBGET integrated database retrieval system