KEGG   Mycobacterium tuberculosis H37Ra: MRA_2730Help
Entry
MRA_2730          CDS       T00540                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
mra00010  Glycolysis / Gluconeogenesis
mra00520  Amino sugar and nucleotide sugar metabolism
mra01100  Metabolic pathways
mra01110  Biosynthesis of secondary metabolites
mra01120  Microbial metabolism in diverse environments
mra01130  Biosynthesis of antibiotics
mra01200  Carbon metabolism
Module
mra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mra_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MRA_2730 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    MRA_2730 (ppgK)
Enzymes [BR:mra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     MRA_2730 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABQ74504
UniProt: A5U654
Position
3028826..3029623
Genome map
AA seq 265 aa AA seqDB search
MTSTGPETSETPGATTQRHGFGIDVGGSGIKGGIVDLDTGQLIGDRIKLLTPQPATPLAV
AKTIAEVVNGFGWRGPLGVTYPGVVTHGVVRTAANVDKSWIGTNARDTIGAELGGQQVTI
LNDADAAGLAETRYGAGKNNPGLVVLLTFGTGIGSAVIHNGTLIPNTEFGHLEVGGKEAE
ERAASSVKEKNDWTYPKWAKQVIRVLIAIENAIWPDLFIAGGGISRKADKWVPLLENRTP
VVPAALQNTAGIVGAAMASVADTTH
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccggccccgagacgtccgaaacaccgggtgccacgacacagcgtcatggc
ttcggcatcgacgtcggcggcagcggcatcaagggcggaatcgtcgacttggacaccggc
cagctgatcggcgaccggatcaagctgctgaccccgcaaccggccactccgttggcggtc
gccaaaaccatcgccgaggtcgtcaacggtttcggctggcggggtccgctgggggtgacc
tatcccggcgtcgtcactcacggcgtcgtccggaccgcggctaacgtggacaagtcctgg
atagggaccaacgcacgcgacactatcggcgccgagctgggcggtcagcaggtcaccatc
ctcaacgacgctgatgccgccgggctggccgagacacgctacggggccggcaagaacaac
cctggcttagtggtactgctcacattcggaaccgggatcgggtccgcggtcatccacaac
gggacgttgatacccaacaccgagttcggacatcttgaggtcggcggcaaggaagcggag
gaaagggccgcctcctcggtaaaggaaaagaacgactggacctatccaaagtgggccaag
caggtgatacgcgtgctcatcgccatcgagaacgcgatctggcctgacctgttcatcgcc
ggcggcggcatcagccgcaaggccgacaaatgggtgccgctactggaaaaccgcacacca
gtagtgcccgcggccctgcagaacaccgccggaattgtcggtgcggccatggcctctgtc
gcagatacgacgcactga

DBGET integrated database retrieval system