KEGG   Meiothermus ruber DSM 1279: Mrub_0329Help
Entry
Mrub_0329         CDS       T01193                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00970  Aminoacyl-tRNA biosynthesis
Module
mrb_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mrub_0329
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mrb01007]
    Mrub_0329
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mrb03016]
    Mrub_0329
   03029 Mitochondrial biogenesis [BR:mrb03029]
    Mrub_0329
Enzymes [BR:mrb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Mrub_0329
Amino acid related enzymes [BR:mrb01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Mrub_0329
Transfer RNA biogenesis [BR:mrb03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Mrub_0329
 Prokaryotic Type
   Other AARSs
    Mrub_0329
Mitochondrial biogenesis [BR:mrb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Mrub_0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1g THDPS_N_2 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ADD27107
UniProt: D3PLZ6
Position
299506..301347
Genome map
AA seq 613 aa AA seqDB search
MLASRPEIKSQLKAAIAQALEALGLQEWPEIVVQETPPDKEGDYGTPVAMSLARTLRKAP
PQIAADLLQNIQLPAWVRRTFVLGGYLNFELDPAFLVKSATLPVAPFPKVAGKVLLEHTS
VNPNKELHVGHLRNICLGDSLARILRFVGRDVEVMNYIDDTGRQAAESLYALQYFGLKEA
PAQTKYDHWVGEAYVRLHQAMEDPEQKARIEQGVQSTLHRLEAGELRDAVDKILRAQLQT
MYRLGAEYNALVWESDIVREGLLGKAMKILEGSPYVSRPTEGKYAGALVMDTSAFIPGLE
DPYLVLIRSNGTSTYTAKDIALQFWKMGLLEGLRFVTYDTQPSGAPLYSTHPEGVPLPFG
GASETINVVDARQSHALRVVQASLEVEGRPDLAEKCFHLAYETVLLEGRQMSGRKGIVVS
VDEVMDEAVKRVRAVIAEKNPDHPSPAEAAEQIGVGAVRFAMLKTEAKKQIDFRYDQALS
FEGDTGPYIQYAYARAGSILRKAEEQGVIQEAPDFTQATPYEVALAKTLLRFPEAVQDAA
RNKAPHIVAQYLLELAAAWSSFYNAKTPDGRPATPVLSAPPELRGVRLELVKALRQTLKQ
GLGLLGLEAPEVM
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
gtgctagcatctcgccccgagatcaagtcccagctcaaagccgccatcgcccaggccctg
gaggccctgggcctgcaggagtggcccgaaattgtcgtacaggaaaccccgccggacaag
gaaggcgactacggtacgccagtcgccatgagcctggcccgcaccctgcgcaaagccccg
ccccagattgccgccgacctgctccagaacatccagcttccggcctgggttcggcgtact
tttgtgctggggggctacttgaatttcgagctcgatccggcctttctggtgaagtcggcc
acgttgcccgttgcgcctttccccaaggttgcaggcaaggtgcttctggaacacacctcg
gtcaaccccaacaaagagctgcacgtcggccacctgcgcaacatctgcctgggggactcg
ctggcgcgcatactgcgctttgtgggccgcgacgtagaagtaatgaactacatcgacgac
accgggcggcaggccgccgagagcctatatgccctgcagtattttggccttaaggaagcc
cccgcccagaccaaatacgaccactgggtgggcgaggcctatgtgcggctgcaccaggcc
atggaagaccctgagcaaaaagcccgcatcgaacagggcgtgcaatccaccctccaccgc
ctggaggcgggcgagctgcgcgacgcggtagacaaaattctgcgggcccaactgcaaacc
atgtaccgcctgggcgccgagtacaacgccctggtctgggagtccgacatcgtgcgggaa
gggctgctgggcaaggccatgaaaatcctggaaggctcgccctacgtttcccgtcctacc
gagggcaagtatgcgggggccctggtcatggataccagcgctttcattcccggcctggaa
gacccctacctggtgttgatccgctccaacggcacctccacctacaccgccaaggacatc
gccctgcagttctggaagatgggcctgctcgagggcctgcgcttcgtgacctacgatacc
cagcccagcggggcgcccctgtacagcacccaccccgaaggcgtgcccctgccgtttggt
ggggccagcgagaccatcaacgtggtggacgcccgccagagccacgccctgcgggtggtg
caggcctcgctcgaggtcgaagggcggcccgacctggccgagaagtgcttccacctggcc
tacgagacggtgctgctcgagggccggcagatgtccgggcgcaagggcattgtggtctcg
gtggacgaggtgatggacgaagcggttaagcgggtgcgggcggtcatcgccgagaaaaac
cccgaccaccccagccccgcggaagccgccgagcagattggggtgggagcggtgcgcttc
gccatgctcaaaaccgaggccaagaagcagatcgacttccgctacgaccaggccctgagc
ttcgaaggggataccggcccctacatccagtacgcctacgcccgcgcaggctcgatcctg
cgcaaggccgaagagcaaggggttatccaggaagcccccgacttcacccaggccacgccc
tacgaggtggccctggccaagaccctgctgcgcttccccgaggccgtgcaggatgctgcc
cgtaacaaagccccgcatattgtggcccagtacctgctcgagctggccgcggcctggagt
agcttctacaacgccaaaacccccgatggccggccggccaccccggtgctcagcgcgccc
ccagagttgcgtggggtgcggctggagctggtcaaggccctgcgccagaccctcaagcag
ggcctgggcctgctgggcctggaagcccccgaggtcatgtaa

DBGET integrated database retrieval system