KEGG   Meiothermus ruber DSM 1279: Mrub_0330Help
Entry
Mrub_0330         CDS       T01193                                 

Definition
(GenBank) transcriptional regulator, SARP family
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA TsaE AAA_5 Trans_reg_C DUF3035 AAA_16 TIP49 NACHT AAA_18 AAA_33 AAA_22 AAA_25 KTI12 Zeta_toxin DnaB_C
Motif
Other DBs
NCBI-ProteinID: ADD27108
UniProt: D3PLZ7
Position
301886..302494
Genome map
AA seq 202 aa AA seqDB search
MNKSGGPIQLKLWGPARLEYQGRELKLQRKGLAILYYLALEGATRREVLADLLWGHSAAS
QNLRVELHRLGQALAPLGYTLFKAGEDPLQLPPFVTLDRTPAPGAPMEGLEEISVEFRAW
LEGQRSQLMANSSGTVGRERLVQEVASQIVLPSVLILTGRPGSGRTAFAQALAKALGMPF
LEGPRGGGKALHYLRPPTPMSR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatccggaggacccattcagctcaaactatggggcccggcccggctggagtac
caaggccgcgaattaaagctccagcgcaagggtctggccattctgtactacctggccctg
gaaggggctacccgccgcgaagtgctggccgacctgctctggggccactcggcggcctca
cagaacctgcgggttgagctgcaccgcctgggtcaggccctggcccccctgggctacacc
ctgtttaaagccggcgaagaccccttgcagctcccgcctttcgtgaccctggatcgcacc
ccggcgccgggggcgcccatggaagggctggaggagatctcggtggagttcagagcctgg
ctcgagggccagcgctcacagctcatggccaacagctccggcacggtggggcgggagcgg
ctggtacaggaggtggcctcgcagatcgtgttgccctcggtgttgattctgaccggacgg
cccggttccgggcgcacggcctttgctcaagccctggctaaagccctggggatgcccttt
ttagagggccctcgaggcggcggcaaggccctgcactacctgcgcccccctacgccgatg
tctcgatag

DBGET integrated database retrieval system