KEGG   Meiothermus ruber DSM 1279: Mrub_0332Help
Entry
Mrub_0332         CDS       T01193                                 

Definition
(GenBank) glutaredoxin
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaredoxin DUF836 GST_N_3 GST_N_2 Thioredoxin_2 Thioredoxin_9 IU_nuc_hydro DUF953 DUF3088 GST_N
Motif
Other DBs
NCBI-ProteinID: ADD27110
Position
complement(303780..304040)
Genome map
AA seq 86 aa AA seqDB search
MITMYTTSWCPDCHAAKQALTSLGLPFQEVNIEHDPTAAELVMKVNNGKRSVPTLVYKEH
ATSLSRFSISKLKAWMEQVGLQAGQP
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgattacgatgtacacaacctcctggtgccccgactgccacgccgccaaacaagccctg
accagcctcggactgcccttccaggaagtcaatatcgaacacgaccccaccgcagccgag
ctggtaatgaaggtcaacaacggtaagcgcagcgtgcccaccctggtgtacaaagaacac
gccacctcgctgagccgcttttccatcagcaagctcaaagcctggatggagcaggtcggc
ctgcaagccggccagccatag

DBGET integrated database retrieval system