KEGG   Meiothermus ruber DSM 1279: Mrub_0339Help
Entry
Mrub_0339         CDS       T01193                                 

Definition
(GenBank) ABC transporter related protein
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
mrb  Meiothermus ruber DSM 1279
Brite
Transporters [BR:mrb02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    Mrub_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C39 ABC_membrane ABC_tran AAA_21 SMC_N AAA_29 Peptidase_C39_2 Peptidase_C70 AAA_23 AAA_18 DUF4491 AAA_33 AAA_30 RsgA_GTPase Guanylate_cyc_2 AAA_25 AAA_15
Motif
Other DBs
NCBI-ProteinID: ADD27117
UniProt: D3PM06
Position
309392..311479
Genome map
AA seq 695 aa AA seqDB search
MKLVRQVDSTDCGPACLAMVLGYWGRKEPLYRLRTLAGTTQSGTSMLGLVRAGRQLGLEV
RALEADLEGLRTLRTPLVLHWEHNHYVVLVRLTPRKVQIADPAVGLRWIGLGELQKKWTG
KLLWLKPEPAFERGNFVSKRGLKGFLAHLAHFRGTGGVLLELTLATIALSLLGLGGPVLS
QLVFDRVLTFREESLLPYLLVAIFALTFFQTLLASLRAHLATQLSMRLNYRLKLSYLHHL
LRLPLRTLEARLPGDLLSRFGDLGQVESILRNLLVGLPSTLLTLVLSFVLLFTYNPKLAW
VALLVVPIHLVYLLWLAPRLRENSLQSLRKGAEVDSYVLGSLEGVTALKALRGEGWALSR
GRDQIAGLNDILWQGFLLSNWGGALVALLGGLFSLFLLWYGAGLVLRLELTVGQLVAAYG
LVQGVTAALGSLSGTVMAIQQGIVASDRLAEVVELEPEQEQKNAVLRPLERAIALEHLCF
SYLPERPLLKDLCLELPKGSYTAIVGPNGAGKSTLGGLLARMLEPQSGRISWDGRDLAEL
SPDAVRERVAYLRQEVPLFYATLRENLSLGHPLPEERLWRVLELVGLMPAVRRLPEGLDT
VVGGESLYRFSSGERQLLGVARALLSPADLLILDEPTATLDPDKERQIVALLRAFKGERT
LLVITHRPALLEPADQVFALQDGVLKPVEPVLQGV
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggttcgccaggtggatagcaccgactgtgggccggcctgcctggccatggtg
ttggggtactggggccggaaggaaccgctgtaccggctacggacattagccggtaccacc
cagtcgggcacctcgatgctgggcttggtgcgtgctggtaggcagctcggcctcgaggtt
cgggcgctggaagcggatctggaagggctccgaaccctaagaacccccctggtgctgcac
tgggagcacaaccactacgtggttctggttcgcctcaccccgcgcaaggttcagattgcc
gatcccgcggtggggttgcgttggattgggcttggggaactgcaaaagaagtggacgggc
aagctgttgtggctcaagccggagcctgccttcgaacggggcaactttgtgagcaagaga
ggactcaagggcttcctggcccacctggcacattttcgcggcacgggtggggtgctgctg
gagctcaccctggccaccatcgccctgagcctgctgggcttgggtgggcctgtcttgagc
caactggtcttcgatcgggtgctgaccttccgtgaggagagtctgctgccttatctgctg
gtggcgattttcgccctgacctttttccagaccttgctggcgagcctgcgggcacaccta
gccacccaactctcgatgcgcctcaactaccggctcaaactaagctacctgcaccacctg
ctgcgtttgccgctgcggacgctcgaggcccggctgcctggcgacctgctctcgcggttc
ggcgatctgggccaggttgaaagcatcctgcgcaacctgttggtgggattgccctcgacc
ctactcaccctggtgttgagttttgtgttgcttttcacctacaaccccaaactggcctgg
gtggcgcttctggtggttcccattcatctggtgtatctgctctggctggccccgcgtttg
cgcgagaacagtctccagagcctgcgcaaaggtgccgaggtagatagctacgtgctgggg
agtctggaaggggtgacggccctcaaggccttgcggggagagggatgggcgctgagccga
ggccgagaccagattgccggcctgaacgacattctctggcagggatttctgctctccaac
tggggtggggctttggtggccttgctgggcgggctatttagcctatttttgctgtggtat
ggcgccggactggtcttgcgcctcgagctcaccgtgggccagttggtggccgcctacggt
ttggtgcagggggtcacggcggccctgggtagccttagtggcactgtaatggccattcag
caaggtattgtggcctccgaccgcctggccgaggtggtcgaactcgagcccgaacaggaa
caaaagaacgccgtgttgcgccccctcgagcgggcaattgccctcgagcatctctgcttt
agctacctgcccgagcgccccctgctcaaagacctgtgcctggaactgcccaaagggagc
tacaccgcgattgtagggcccaacggggcgggaaagagcaccctggggggtttgttggcg
cggatgctcgagccccaatcggggcgtattagctgggatgggcgcgacctggccgagctt
tcccccgatgcggtacgggagcgggtggcgtatttgcgccaggaggtgcccctgttctac
gcgaccctgcgtgaaaatctgagcctgggacaccccctgccggaggaaagactttggcgg
gttctggagctggtgggcctcatgcctgcggtacggcgcttacccgaggggctcgacacc
gtggtgggtggcgagagcctctaccgcttcagcagcggcgagcggcaactgctgggggtg
gcccgcgccctcctaagccctgccgacctgctaattctggacgagcccaccgccaccctc
gaccccgataaggagcgccaaattgtcgccctgctccgggcttttaagggtgagcgtacc
ctgctggtgatcacccaccggcctgccctgctcgagcccgccgatcaagtcttcgcgttg
caggatggggttctgaagcccgtcgaaccggtgttgcagggggtgtaa

DBGET integrated database retrieval system