KEGG   Meiothermus ruber DSM 1279: Mrub_0341Help
Entry
Mrub_0341         CDS       T01193                                 

Definition
(GenBank) transcriptional regulator, LuxR family
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE HTH_23
Motif
Other DBs
NCBI-ProteinID: ADD27119
UniProt: D3PM08
Position
312463..313026
Genome map
AA seq 187 aa AA seqDB search
MIRVLSGSRLIQESLTLALGNLLLRRAVVLVADYPLGSALALLPGVQGPCVVKTASDSPY
YLSDLVALGPAGLVLEGAGLDFLRWTLQQVSEGQRVLPRLGEVGLTRKERAVLRLLVGGV
CNDAISAHLGISPRRTANLVSTVKRALGAETRADVVLRYFGLAPEPIIKATLQKTGNFSL
PHEVETA
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgatccgggtattgagcggctcgaggctgattcaggaaagcctgaccctggccttaggt
aacctgctcctccgccgtgcggtggtgctggtagccgactaccccctgggcagcgccctg
gccttgcttccaggcgtacaggggccttgcgtggtcaagactgcctcggactcgccttac
tacctttccgatctggttgcactgggccctgctggcctggtactggagggtgcgggtcta
gacttcctcaggtggacactgcagcaggtttcggaggggcaaagggtcttgcccaggctt
ggggaggttggtcttacacgaaaggaacgcgccgtactgcggctgctggtgggtggtgtt
tgcaacgatgcgatatctgcccatctcggcatcagtccgcgtcgcacggccaacctggtt
agcaccgtcaagcgggctctgggtgccgagacccgcgccgatgtggtactgcgctacttt
ggtctggcccctgaaccaatcattaaggcgacccttcaaaaaaccggtaacttttcactc
ccgcacgaggtcgaaactgcctag

DBGET integrated database retrieval system