KEGG   Meiothermus ruber DSM 1279: Mrub_0360Help
Entry
Mrub_0360         CDS       T01193                                 

Definition
(GenBank) glycosyl transferase group 1
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_trans_4_4 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2 ETF Glyco_trans_4_2 SERTA
Motif
Other DBs
NCBI-ProteinID: ADD27137
UniProt: D3PM26
Position
complement(336254..337492)
Genome map
AA seq 412 aa AA seqDB search
MRFLFLTQYFPPEIGAAQVRLASVIRELVRLGHQVEVVTAMPNYPTGRVFEGYRGRLWLE
EDWEGVRVVRTWLYPAMGTGPKRLLNYFSFVLSALGGVLKVQKPDYIFVESPPLFLSLTG
YLASRRFGVPFIFNIADLWPDSVRQLGLMKEGPLLCLAEGLESWSYRQAHFITAVTEGIQ
KVLLEEKKVPPHKILYLPNGVDTDLFKPMPPDLALARELGLEGKKIILYAGNHGYAHGLE
VALQAARLLTDPQVVLVLIGDGSEKPRLKQMAQEMGLTNVRFLDPKPPAYIAQLYSLAVA
GLSTLRNSPLFEMTRPVKIFAGMSCAKPILYAGQGEGARLVEGARAGLVSLPEDAQTLAH
NIMAVVQNPHLAEQLGQNGRRYVETHLSWSVLIENWLYQLQSQQPKAEKVPV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcttcttgtttctaacccagtactttccccccgagatcggcgcggcccaggtgcgg
ctggcttcggttatccgcgagctggtgcggttagggcatcaggtagaggtagtgacggcc
atgcccaattaccccaccgggcgtgtgtttgagggttaccgcggcaggctctggctcgag
gaagactgggaaggggtgcgggtggtgcgcacctggctctaccccgccatgggcaccggc
cccaagcggctgcttaactacttcagctttgtgctgagcgcgctgggtggagtgctaaag
gttcaaaagcccgactacatctttgtggaatcgccgcccctgtttctgagcctaacgggc
tacctggcctcgaggcgctttggtgtgcctttcatcttcaacatagccgatctctggccg
gactcggtgcgccagctcggtctgatgaaggaaggccctttgctgtgcctggccgagggc
ctggaaagctggagctaccgccaggcccacttcatcaccgcggtgaccgagggcatccag
aaggttctgctggaagagaaaaaagtacccccgcacaagatactttatctacccaacggc
gtggataccgatctcttcaagcccatgccgcccgacctggccctggctagggagcttggc
ctcgagggcaagaaaatcattctgtacgccggcaaccacggctacgcccacggcctggag
gtggccctgcaggccgcccggctcctgaccgacccccaggtggtgctggtgctcatcggc
gacggctcggaaaaaccccgcttgaagcagatggcccaggagatggggcttaccaatgtg
cgcttcctggatccaaagcccccagcctacatcgcccagctctactctctggccgtggcc
ggcctttccaccctgcgcaactccccactcttcgagatgacccgcccggtcaagattttc
gccgggatgagctgcgccaaacccatcctgtacgccgggcagggggagggggcgcggcta
gtggagggggctcgagccggcctggtaagcctccctgaggacgcccaaaccctggcccac
aacatcatggcggtggtacagaacccccatctggccgaacaactgggccagaacgggcgg
cgctacgtggagacccacctaagctggtcggtgctcatcgaaaactggctgtaccagctt
caatcccagcaacccaaggccgaaaaagttccggtgtaa

DBGET integrated database retrieval system