KEGG   Meiothermus ruber DSM 1279: Mrub_0366Help
Entry
Mrub_0366         CDS       T01193                                 

Definition
(GenBank) hypothetical protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADD27143
UniProt: D3PM32
Position
343952..344857
Genome map
AA seq 301 aa AA seqDB search
MSTPSKPLKFQQALRSSWHRFYSDFLLPSRVHELRSLLEQALAQGYQVHSIASIWEKIKA
GQLQDGPYLVLRLDIDTDLRTTRALWQVVREMGVQASFYFRLSTLDVNLMQEIHASGSEA
SYHYEEIATYAKRHRLKNRAEVEACMPAIRALFAENYRRIKALTGLPLHTVASHGDWLNR
RLGVINHELLQDRGLREELGIELEAYDPVLQQRYTQRFSDGAYPNLWLDGNPLEAIRTGL
PFVEVLLHPRHWGANIPVNLRDNLHRLGEELAYRQSGWFCLIGPMISLWPIVQGGLVESG
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgccttcgaagccccttaagttccagcaggccctgcggtcgagctggcaccgc
ttttactccgactttttgctccccagccgggtgcatgaattgcgcagcttgctcgagcag
gccctggcccagggctaccaggtgcactccatcgcttccatctgggagaaaatcaaggcc
gggcagcttcaggatggcccatacctggttttgcggctggacattgatactgacctacgt
accacgcgggctttgtggcaggttgtgcgtgaaatgggtgtgcaagcctcgttttacttt
cggctctctacgctggatgtgaacctgatgcaggagattcacgcttccggtagtgaggcc
agctaccactacgaagagatcgccacctatgccaaacgccaccgccttaaaaaccgcgcc
gaggttgaggcttgtatgcctgccattcgagcgctctttgcggagaactaccgccggatt
aaggccctcaccggtctgcccctgcacacggtggcctcccacggtgactggctcaaccgc
cggttgggggtgatcaatcatgaactgttgcaagaccgaggcctgcgtgaggagctgggt
atcgagctcgaggcctacgatccggtcttgcaacaacgctacacccaacgtttttctgat
ggggcctaccccaacctatggctggatggcaaccccctcgaggccatccgcaccggtctt
ccgtttgtagaagtcctgctgcatccccggcactggggggccaacatccccgttaatttg
cgagacaacctgcaccgcctgggcgaggagctggcctaccgccaatccgggtggttttgc
ctgatcgggccgatgatttctctgtggcccatagttcaaggcggtcttgtggaaagtgga
ttctga

DBGET integrated database retrieval system