KEGG   Meiothermus ruber DSM 1279: Mrub_0372Help
Entry
Mrub_0372         CDS       T01193                                 

Definition
(GenBank) glycosyl transferase family 4
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4
Motif
Other DBs
NCBI-ProteinID: ADD27149
UniProt: D3PM38
Position
354868..355812
Genome map
AA seq 314 aa AA seqDB search
MNELLLALLATLTAAVLVGLSLPLARSLGIVDRPGVIKIHTLPTPRFGGVGIVASVLLWG
YYTQVVAGWALLGLLVIAITGGLDDRFSLSPRLRLLAELVAGVVLGMHFWSALGWGGVGL
AVVLVLLMSNAVNLIDGMNGLAAGNALISAVGIAILLWSIPAGAGLAVILAASLLGFLFW
NYPRAKTFMGDSGSLSIGYLLAMLLLMAAAQGGATFGAALMMVGFPLYDTAAGIIRRWRR
GKPIFDGDRDHTYDRLDQLYLRNPAKTVAVVWLVSGVLVLAGLVIGKVDVGMGLVLGVLL
AAVLFWGAYRLGSL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaactgctgctggctttgttggcaacgctgaccgctgctgtattggtagggcta
tccctgcccctggcccggagcctgggtattgttgatcggccgggggttatcaaaattcat
accctgcccaccccgcggtttggtggggtggggattgtggccagtgtgctgctttggggc
tattacacccaggtggtggctggctgggctttgctgggattgttggttatagctattacg
ggcggtctggatgaccgctttagcctttcgcccaggctgcgcctgctggccgagctggtc
gccggggttgtgctgggtatgcatttctggagtgctttggggtggggtggggtggggctg
gcggtggttctggtattgcttatgtccaacgcggtcaacctgattgacgggatgaacggt
ctggccgccggcaacgccctgatctcggccgttggaatcgccatcttgttgtggtcaatt
cctgccggggctgggctggctgtaattttggctgcgagcttgctagggtttctattctgg
aactaccctcgagccaagacctttatgggtgatagcggcagtctatccattggctatcta
ctggccatgctgctcttgatggccgcagcccagggtggggccacctttggggcagcgctg
atgatggtgggcttccccctgtacgataccgcagcgggcattatccggcgctggcggcgg
ggtaagcccatctttgacggggatcgggatcacacctacgatcgactggatcagctttat
ttgcggaacccggccaagaccgtggcggtggtctggctggtgagcggggtgttggtgctg
gcagggctggtgataggcaaggtggacgttgggatgggcttggttttgggggtgttattg
gcggctgttctgttctggggcgcgtacaggctgggctcgttgtag

DBGET integrated database retrieval system