KEGG   Meiothermus ruber DSM 1279: Mrub_0377Help
Entry
Mrub_0377         CDS       T01193                                 

Definition
(GenBank) Methyltransferase type 11
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Ubie_methyltran Methyltransf_12 Methyltransf_31 Methyltransf_23 PrmA N6_N4_Mtase FtsJ Methyltransf_33
Motif
Other DBs
NCBI-ProteinID: ADD27154
UniProt: D3PM43
Position
358708..359385
Genome map
AA seq 225 aa AA seqDB search
MQELSPDQRPKAPLTLAARTNLWPLTALGYEVWRRRALTLLSGRPFPLEEELSLMLTRVQ
PVVGRVFLDLGTSTGLYARALLEAGAARVYALDLSPAMLRVALQKARGHPGFVPLLARAE
AIPLPQASVDGVVVGGSWNEFPDPQPVIHELYRVLKPDGRLWVMFSHRSQSPLQRLLEAA
GLRFPTLSGLMDSLTQSGFKVDGWREGSVGFVAGTKVTMQSSVQS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaattgtcccccgaccaacgccctaaagcaccccttacgctggcggcccgcacc
aacctgtggcccctcaccgccctgggctacgaggtctggcgccggcgggccctcacgctg
ctatccggcagaccctttcccctagaagaagagctttcgctgatgctcacacgggtgcag
ccggtggtggggcgggtttttctggatctgggcacctccaccggcctgtacgccagggct
ttgctcgaggcgggcgcggccagggtctacgccctcgatctatcgccggccatgctgagg
gtagcccttcagaaagccagaggacaccccggtttcgtacccttgctggccagggccgag
gccatcccactgccccaggcttcggtggatggggtggtggtggggggtagctggaacgag
tttcccgatccccaaccggttatacacgaactgtacagggtgctgaaaccagacgggcgg
ctctgggttatgttcagccaccgctcgcaaagccctctgcagcgcctgctggaagcggct
gggctgcgctttcccaccctttcagggcttatggattcactcacacaaagtggtttcaag
gtagacggttggcgggaggggtcggtaggatttgtggcagggacaaaagtcactatgcag
agctcggtgcaatcttag

DBGET integrated database retrieval system