KEGG   Meiothermus ruber DSM 1279: Mrub_0378Help
Entry
Mrub_0378         CDS       T01193                                 

Definition
(GenBank) Phytoene synthase
  KO
K02291  15-cis-phytoene synthase [EC:2.5.1.32]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00906  Carotenoid biosynthesis
mrb01100  Metabolic pathways
mrb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    Mrub_0378
Enzymes [BR:mrb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.32  15-cis-phytoene synthase
     Mrub_0378
Prenyltransferases [BR:mrb01006]
 Terpene biosynthesis
  Squalene/phytoene synthase
   Mrub_0378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SQS_PSY
Motif
Other DBs
NCBI-ProteinID: ADD27155
Position
359421..360254
Genome map
AA seq 277 aa AA seqDB search
MRMEPNWQAVSAIIRHHSATFYYGSLLFRGETRKGAWAVYAACRIGDDAVDESANPRADL
DEWWAGIERAYAGVPREDWEAALAWALARWEIPKQAFADMKEGFLADLNPVRLNTLEELY
TYCYRVAGTVGLMIAPIGGAGEAGRDAAIKLGQAMQLTNCLRDVGEDLALGRVYLPAELM
RKYEVSLEDLRQGHISPRYIGLMRELAQEARRLYREGLAGLKHLKTGRGAVALAALQYQG
ILDKLEINGWDNLSRRASLSAYERVMLLPKAIWLRGA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatggaacctaactggcaggctgtatcggccattatccggcatcactcggccacg
ttctactacggtagcctgctgttccggggtgagacccgcaaaggggcctgggccgtgtac
gcggcctgccgcattggggacgacgcggtggacgagtcggccaacccccgggccgacctg
gacgagtggtgggcgggcatcgagcgggcctatgccggggttcctagggaagactgggaa
gcggccctggcctgggctctggcgcgctgggagattcccaaacaggcctttgccgatatg
aaagagggcttcctggccgacctgaacccggtgcggctcaacaccctggaggagctttac
acctactgctaccgggtggcgggcaccgtggggttgatgattgcgcccataggcggggct
ggggaggccgggcgggacgcggccatcaagctgggccaggccatgcagcttaccaactgc
ctgcgcgacgtgggggaagacctggccctgggccgggtttatctgcccgccgagctgatg
cgtaaatacgaggtgtccctcgaggatctgcgccagggccatattagcccgcgctacatc
ggcctgatgcgcgagctggcccaggaggcccgccggctctaccgcgaggggctggctggc
ctcaagcatctgaaaaccgggcgtggggcggtggccctggccgctttgcagtaccagggc
attctggacaagctggagataaacggctgggacaacctctcgcgccgggcctcgctttcc
gcctacgagcgggtgatgctcctgcccaaggccatctggctgcgcggggcctga

DBGET integrated database retrieval system