KEGG   Meiothermus ruber DSM 1279: Mrub_0388Help
Entry
Mrub_0388         CDS       T01193                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_3 Acetyltransf_1 Acetyltransf_8
Motif
Other DBs
NCBI-ProteinID: ADD27165
UniProt: D3PM54
Position
complement(369084..369647)
Genome map
AA seq 187 aa AA seqDB search
MTLSNTWPRHGKVTLKPFTEALTETEWRRFYECFRDPEIAEWNGSRPLRMPLWLFKRVVM
GEVSRGDRMGFGILDENGEWLGTVELYEMSRTEATLGILIGAKDRWGQGYGTDAVRAVLE
YAFCTLRLQKVRLRTYKHNLRAQRAFQKAGFRYLEPPPAPTPRFNFGLAPKAEFVPMEIT
REDWTCY
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctcagcaacacctggcctcgccacggcaaagtgaccctcaaaccctttaccgaa
gccctcaccgagaccgagtggcggcgcttttacgagtgttttcgtgatccggagattgcc
gagtggaacggaagccgtccactcaggatgcccctgtggcttttcaagcgggtggtgatg
ggtgaggtcagccggggcgatcggatggggtttggcatcctggacgagaacggggagtgg
ctgggcacggtagagctttacgagatgagccgcaccgaggccaccctgggcatcctgatt
ggcgccaaagatcgttggggacagggctacggcaccgatgcggttcgggcagtgctcgag
tacgccttctgcaccctgcggctgcaaaaggtcaggctgcgcacctacaaacacaacctt
cgagcccaacgagccttccagaaggccggctttcgctacctcgagcccccacccgccccg
accccccgcttcaatttcggcctggctcccaaggctgagtttgtgcccatggagattacc
agggaagactggacgtgctactga

DBGET integrated database retrieval system