KEGG   Meiothermus ruber DSM 1279: Mrub_0406Help
Entry
Mrub_0406         CDS       T01193                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
mrb  Meiothermus ruber DSM 1279
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Mrub_0406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ADD27183
Position
384971..385363
Genome map
AA seq 130 aa AA seqDB search
MSASLPIRNDIHVKVEVVYAQAHSRPGQHVFVYFITLENQGHETVQLLRREWFIQDGWGG
VVHVEGEGVVGEKPILEPGQLYRYNSFCPLAHPPGLMWGFYTFQNMLGALFRVEIPAFAL
RLPDAHRTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggcgagcttgcccatccggaacgacatccatgtgaaggtagaggtggtctacgcc
caggcgcactcgaggcccgggcagcacgtctttgtatacttcatcaccctggaaaaccag
ggccacgagacggtgcagctcctgcgtcgggaatggttcattcaagacggctggggtggg
gtggtgcacgtggagggtgagggggtggtgggtgagaagcccatcctcgagcccggtcag
ctttacagatacaacagtttttgccccttggcccacccccctggcttaatgtggggtttc
tataccttccagaacatgctgggcgcgctgttccgcgtcgagataccggcctttgccctg
cgcctgccggatgcccaccgcaccctcaactag

DBGET integrated database retrieval system