KEGG   Meiothermus ruber DSM 1279: Mrub_0409Help
Entry
Mrub_0409         CDS       T01193                                 

Definition
(GenBank) cell division ATP-binding protein FtsE
  KO
K09812  cell division transport system ATP-binding protein
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb02010  ABC transporters
Module
mrb_M00256  Cell division transport system
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Mrub_0409
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mrb03036]
    Mrub_0409
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mrb02000]
    Mrub_0409
Chromosome and associated proteins [BR:mrb03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Mrub_0409
Transporters [BR:mrb02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cell division transporter [MD:M00256] [OT]
    Mrub_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 RsgA_GTPase Zeta_toxin AAA_29 AAA_22 MMR_HSR1 PIF1 SMC_N DUF244 AAA_33 Dynamin_N AAA_5 IstB_IS21 AAA_15 APS_kinase DUF815 RNA_helicase AAA_23 AAA_PrkA
Motif
Other DBs
NCBI-ProteinID: ADD27186
UniProt: D3PML1
Position
387614..388300
Genome map
AA seq 228 aa AA seqDB search
MIHFHRVMLEYPRTQTKALFDLNLEIKKGEFVFLVGHSGAGKSSLLNLILKRLEPTSGAV
YFAGENLKALHGDRIALHRRRIGVVFQDHRLLRDRTVEENLLFTLHVLGVPRHEWDLRVT
RVLRQVGIVHKKRAYPDELSVGEAQRVAIARALVGDPQVLLADEPTGNLDPANALAVLEI
FKLVHARGATVLVATHSRDLVEAYPQRVVVLKAGQLVRDDREGRYSLV
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgatccactttcatcgggtgatgctcgagtacccccgtacccagaccaaggccctcttc
gacctgaacctggaaatcaaaaaaggcgagtttgtttttctggtcgggcactcgggcgcg
ggtaaatcgagcctgctaaatctgatcttgaagcgcctcgagcccacctcaggggcggtt
tattttgccggtgagaaccttaaagccctgcacggcgaccgcattgccctgcaccgccgg
cggatcggggtggtcttccaggatcaccggctgctgagggatcgcaccgtcgaagagaac
ctgcttttcaccctgcacgtgctgggggtgcccagacacgaatgggatctgcgggtgacc
cgtgtgttgcgccaggtggggattgttcacaagaagcgggcctaccccgacgaactttcg
gtgggggaggcccagcgggtggccattgccagggccctggtgggcgacccccaggttttg
ctggccgacgaacccaccggcaacctcgacccggccaacgccctggcggtgctggaaatt
ttcaaattggtgcacgctcgaggggccaccgtgctggtggcgacccactcccgcgatctg
gtggaagcctatccccagcgggtggtggtgctcaaggccggccagttggtgcgcgatgac
cgggaggggaggtacagcctggtttga

DBGET integrated database retrieval system