KEGG   Meiothermus ruber DSM 1279: Mrub_0412Help
Entry
Mrub_0412         CDS       T01193                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14155  cystathione beta-lyase [EC:4.4.1.8]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00270  Cysteine and methionine metabolism
mrb00450  Selenocompound metabolism
mrb01100  Metabolic pathways
mrb01110  Biosynthesis of secondary metabolites
mrb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Mrub_0412
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Mrub_0412
Enzymes [BR:mrb01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.8  cystathionine beta-lyase
     Mrub_0412
Amino acid related enzymes [BR:mrb01007]
 Aminotransferase (transaminase)
  Class II
   Mrub_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ADD27189
UniProt: D3PML4
Position
complement(389704..390864)
Genome map
AA seq 386 aa AA seqDB search
MQLDELSPRTLRDPYGYSGKWHFYPADVLPMWVADMDFPISPAITQAIVERLQERVGYPQ
MKGDGLLLERIIQQQSQFGLEGLTPENLLLTTSVVPAIYASVLALSSPGDEVITQVPVYP
PFLNALSEHHRIARHNPLQPTPSGWEIDFDQLERLVTPRTRLLLLCNPQNPTGRVFRRDE
LERLAEFALRHRLWVMSDELWADLIYEGQHIPIASLSPEIAQRTVTLTGPCKSYNTAGLG
GGVAISHNKQILSAMAQVSKGLGGHPNVLAMAAWRAALEHAQDWLQQVRAYLKGNRDLVT
GFMQQRLPQVGYRPPQGTYLAWLDFSQTPLAQEAHKIMLEQAKVGLNDGRMFGPQYQGWL
RLNFATSRSLVQEALERIARVVQAVD
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcaattggacgagctatcgccccgcaccctgcgcgatccctacggctacagcggcaag
tggcacttttaccctgcggacgtactgcccatgtgggtggccgacatggacttccccatc
agcccggccatcacccaggccattgtagagcggctgcaggagcgggtgggctatccccag
atgaaaggggatgggctgctgctggaacgcattattcagcagcaaagccagttcggtctg
gagggtcttacccccgaaaacctgctgctcaccacctcggtggtgccggccatctacgcc
agcgtgctggccctgagcagccccggcgatgaggtgatcacccaggtgccggtctatcct
ccgtttctcaacgccctcagcgagcaccaccgcatcgcccggcacaacccgctgcaaccc
acccccagcggctgggagattgactttgatcagctcgagcgcctggtgaccccccgcacc
cggctactgctgctgtgcaacccccagaaccccaccgggcgggtcttccgacgtgacgag
ctggagcgactggccgagtttgccctgcgccaccgcctgtgggtgatgtccgacgaactc
tgggccgacctgatttacgagggccagcacatccccattgcctctttgagccccgagatt
gcccagcgcaccgtgaccctcaccgggccctgcaagtcgtacaacaccgccgggctgggc
ggcggggtggccatcagccacaacaagcagatcctgagcgccatggcccaggttagcaag
ggccttgggggccaccccaacgtgctcgccatggcagcctggcgggctgcgctcgagcac
gcccaggactggctacagcaggtgcgggcctacctgaagggcaaccgcgacctcgtcacc
gggtttatgcagcagcgcctaccccaggtgggctaccggcccccgcaaggcacctacctg
gcctggctggacttctcacaaacgcccctggcccaggaggcgcacaagatcatgctggaa
caggccaaagtcggcctcaacgatggcaggatgttcgggccgcagtaccagggctggctg
cgtctaaactttgcgaccagccgctcgctcgtgcaagaggcgctcgagcgcattgcacgg
gtagtccaggcggtcgattag

DBGET integrated database retrieval system