KEGG   Meiothermus ruber DSM 1279: Mrub_0413Help
Entry
Mrub_0413         CDS       T01193                                 

Definition
(GenBank) diguanylate cyclase
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF DsbD_2 NfeD
Motif
Other DBs
NCBI-ProteinID: ADD27190
Position
complement(390915..392036)
Genome map
AA seq 373 aa AA seqDB search
MLPRPAPDPYVTLEVADPLETLRIRLTLWLLPLGAGAALTAWGLSVTSNKLSLPDQYLLL
PMAVGFIALEFHLWRNPQNVRWVWQIALALIAIYEIVSLFYEAAYKLHQRDGITPAALWF
PMVYLMAFNLLNRRQALRFSLVYLVLGLLAGAVGMLMSPSINVSSINTALQFTFSNIAYL
ALLYMFAYLRRHYAQMHQMAHTDALTNLTNRRAMQQKLEGELDRARRYNRPFALLLADLD
HFKQINDTYGHSVGDQVLREVAGRLAQHLRESDSLARWGGEEFLILAPETDLQQAYLLAQ
RLLGAIRESPISGVQVTLSLGVACYRQGDSIAALLSRADEAMYRAKAGGRNQIVLEEELE
DIVIPSHSTTPEL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccgcccagcccctgacccctacgtaaccctcgaggtggccgatcccctcgag
accctgcggattcgcctcaccctgtggttacttcccctcggggccggggctgccctaacc
gcctgggggctgtcggtcacctccaacaaattatcgctgcccgatcagtatctgctgctg
ccaatggccgtggggtttatcgccctggaatttcacctctggcgcaatccgcagaacgtt
cgatgggtctggcagattgccctggccttaatagcaatttacgagattgtcagtctattt
tatgaagccgcctacaaactacaccagcgcgacggcattacccctgcagccttgtggttt
cccatggtctacctgatggccttcaatctgctcaaccgcagacaggccttgcgtttttcg
ctggtgtatctggttctgggtttgctggcgggcgcagtgggcatgctcatgagcccttcc
attaacgtctcctctatcaataccgccctgcagttcaccttttccaacatcgcctacctg
gccttgctgtacatgtttgcttacctgcgccggcactacgcccagatgcaccagatggcc
cataccgatgccctcaccaacctgaccaaccgccgggccatgcagcaaaaactggagggt
gagctggatcgggcccgccgctacaatcgcccttttgcactcctgctggccgacctcgac
catttcaaacaaatcaacgatacctacggccattcggtgggcgatcaggttttgcgggag
gtggccgggcggctggcgcagcacctgcgtgagagcgatagcctggcccggtggggcggt
gaggaatttctgatcctggcccctgagaccgaccttcaacaggcctacttgctggcgcaa
cggctgctgggagccatccgcgaaagccccatatcgggcgtgcaggtcacgctaagtctt
ggggtggcctgctaccggcaaggtgacagcatcgccgccctgctaagccgcgccgacgag
gccatgtaccgggccaaggccggtggccgcaatcagattgtgctggaagaggaactcgaa
gacatcgttattccttcccactccaccacaccggagttgtga

DBGET integrated database retrieval system