KEGG   Meiothermus ruber DSM 1279: Mrub_0423Help
Entry
Mrub_0423         CDS       T01193                                 

Definition
(GenBank) 3-hydroxybutyryl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00360  Phenylalanine metabolism
mrb00362  Benzoate degradation
mrb00650  Butanoate metabolism
mrb01100  Metabolic pathways
mrb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mrub_0423
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Mrub_0423
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mrub_0423
Enzymes [BR:mrb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     Mrub_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH NAD_binding_2 F420_oxidored UDPG_MGDP_dh_N XdhC_C NAD_Gly3P_dh_N 2-Hacid_dh_C AlaDh_PNT_C Sacchrp_dh_NADP Pyr_redox_2 DapB_N DFP adh_short_C2 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ADD27200
UniProt: D3PMM5
Position
401997..402869
Genome map
AA seq 290 aa AA seqDB search
MEIRKIGVIGAGQMGAGIAQVAAQAGYTVVLRDLEQAFLERGLSSIKRSIGKLLEKGKLD
QQAHDAALARITTTTHLSDLNDCDLVIEAIVEHEPTKLELFRELDALLQPAAILASNTSS
IPITRLASATRRPERFIGMHFMNPVPLMELVEVIRGHLTDEATTQAVLEVARRMGKTPVE
VNDYPGFVSNRILLPMLNEAIQCVMEGVATPEAIDQVMKLGMNHPMGPLTLADFIGLDTC
LSIMEVLHRGLGDDKYRPSPLLRKMVQAGLLGRKSGRGFYRYDEKGNKIG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcgcaagattggtgtgatcggtgcagggcagatgggggcgggcattgcccag
gtggcggcccaggcggggtacacggtggtgttgcgcgacctcgagcaggccttcctcgag
cgcggccttagcagcattaagcgttccatcggcaagctgctggaaaaaggtaagcttgac
cagcaggcccacgacgcggccctggcccgcatcaccaccaccacccacctatccgacctc
aacgactgcgacctggtgatcgaggccatcgtggagcacgagcccaccaagctcgagctt
ttccgcgagctcgacgccctcctccagcctgcggccatcctggcctccaacacctcctcg
attcccatcacccgcctggcctcggccacccgccggccggagcgctttatcgggatgcac
tttatgaacccggtgcccctgatggaactggtggaggtgatccgcggccacctcaccgac
gaggccaccacccaggccgtgctggaggtggcccgccgcatgggcaagaccccggtggag
gtcaacgactaccccggtttcgtctccaaccgcatcctgctgcccatgctcaacgaggcc
atccagtgcgtgatggagggggtggccacgcccgaggccatcgaccaggtgatgaagctg
ggcatgaaccaccccatgggccccctcaccctggccgacttcatcgggctggacacctgc
ctctccatcatggaggtgttgcaccgggggctgggcgatgacaaataccggccctcgccc
ctgctgcgcaagatggtgcaggccgggcttttgggccgcaagagcgggcggggtttttac
cgctacgacgaaaagggcaacaagatcggatga

DBGET integrated database retrieval system