KEGG   Meiothermus ruber DSM 1279: Mrub_0425Help
Entry
Mrub_0425         CDS       T01193                                 

Definition
(GenBank) transcriptional regulator
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4032 ParBc
Motif
Other DBs
NCBI-ProteinID: ADD27202
UniProt: D3PMM7
Position
complement(403464..404372)
Genome map
AA seq 302 aa AA seqDB search
MDSEHQAQLEAEALSRRVLVHDILRRLRGQPNDLLPYSAVSSLRPRGESYKGLQTIEVDK
IIGSVDRYGDFDAEFMPKEPFTLDRWTKLRQAQLEGVEFPPIHVYKVGDAYFVKDGNHRT
ALAKAQGQHYIDAYVIELEVPVDLDPDDTLKDVILKGEYAAFLEQTRLPELRPHHEPILF
SRPGRYDVLLDHIRTHQYFMGLDQKRSIGWEEAVADWYDNLYLPTILEIRENGVLKNFPG
RTEADLYLWISDHRYFLSQAIGHDVGPEEAALSVQRSVQKGPISRFLDWLGRFFVRQSPQ
PG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggattcagagcatcaagcccagctagaggccgaagccttgtcgcgtcgtgtattggtt
cacgatattctgcgtcgcctgcgcggccagcccaacgatctgctgccctacagcgcggtt
tccagcctgcgcccccggggtgagtcgtacaaaggactgcaaaccattgaggtggataaa
atcatcggctcggtggatcgctacggtgacttcgatgccgagttcatgcccaaagagccc
ttcaccctggatcgctggaccaagctccggcaggcccagctcgagggcgtggagtttcca
ccgattcacgtctataaggtaggggacgcctactttgtaaaagacggcaaccaccgcacc
gctttagccaaagcccagggccagcactacatagacgcttacgtgatcgagctcgaggtg
ccggtagatctcgaccccgacgacaccctcaaagatgtgattctgaagggcgagtacgcc
gcgtttctagagcagacccggctacccgagctgcgcccccaccacgagcccatcctgttc
agccggcccggccgctacgacgtgctgctcgatcacatccgcacccatcagtatttcatg
ggccttgaccagaagcgctcgattggctgggaagaggcggtcgccgactggtacgacaac
ctctacctgcccaccattctggagattcgcgagaacggcgtgctgaaaaactttccgggc
cgtaccgaggccgacctgtacctgtggatctccgaccaccgctacttcctgtcccaggcc
atcgggcacgatgtgggccccgaagaggcggccctttcggtgcagcgcagcgtccagaaa
ggccccatcagccgatttctggactggctgggccggtttttcgtccggcagagcccccag
cctggctaa

DBGET integrated database retrieval system