KEGG   Meiothermus ruber DSM 1279: Mrub_0430Help
Entry
Mrub_0430         CDS       T01193                                 

Definition
(GenBank) MOSC domain containing protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MOSC
Motif
Other DBs
NCBI-ProteinID: ADD27207
UniProt: D3PMN2
Position
complement(407595..408050)
Genome map
AA seq 151 aa AA seqDB search
MPQLLSLHAGLAPSLPKPALLQVRLVEGQGVEGDRHFGRHPDRAVLVAGQTSYAKAHQAG
IELPWGALGENLLVDFDPHALGPHSRLKIGTAVLELTTVCTVCDTLSAFDLRLPKVLYNA
RGVYARVLQGGLVRVGDPVEVLTPDSLLRMG
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaactgctctccctccacgccgggctcgcccccagcctgcccaaaccggcctta
ttgcaggttcgcctggtcgagggccagggcgtggagggtgatcggcactttggccggcac
cccgaccgggcggtgctggtggcggggcagaccagctacgcgaaagcgcaccaggccggc
atcgagctgccctggggggctctgggcgagaacctgctggtggacttcgacccccatgcg
ctgggcccgcacagtcggttgaagattggaacggcggtgctcgagctcaccaccgtctgc
acggtctgcgacaccctatcggccttcgacctgcgcttacccaaggtgctttacaacgcc
cgtggtgtttacgccagagtcctgcagggcgggctggtgcgggtgggcgacccggtggag
gtgctcaccccagattccctgctccgcatggggtag

DBGET integrated database retrieval system