KEGG   Meiothermus ruber DSM 1279: Mrub_0441Help
Entry
Mrub_0441         CDS       T01193                                 

Definition
(GenBank) protein of unknown function DUF450
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TaqI_C Eco57I N6_Mtase HSDR_N
Motif
Other DBs
NCBI-ProteinID: ADD27218
Position
421869..426149
Genome map
AA seq 1426 aa AA seqDB search
MLNLSEGQTESVPISLRNQEAERLRDFDGLFQIYLVRYKAYPPTKQVEAYLAKTGSSALV
LFTSDEKSFVLSYVDGDRAINARAQKDWVENLLKDLLELYQETGDVLKLSESAQDAIHAQ
ADENINRQKRPYRNQGLFSDHYLDTRLRESSEWLEDSEPLRKRLLELYKDKESLLKVANE
AQTEDEFIRPVLESLGFAYWVQDTTKATGGPQRPDYVLYPDEGTKSRAVVHKANEAKRYA
PALAIAEAKYWGRDLDVKRKDGRDRVQSPVSPSFQLSDYLSSTSLEWGILTNGQEWRLYW
GKAADKQKRYFAVDLVQALQDPEAFRFFWLFFRREAFTKGAQGSFLGRILEGSEQYGLRV
GKRLKGVVFEQVFPLLAEGFLRYHKQVLKQPPDKAMLQETYRATLSLLYRLLFLLYAEDR
DLLPVSDTLGYQQYSLSRIRRNVAEWLDQGRAYSEQSYSLWERLSTLFTFIDKGDSTLRV
PPYNGGLFKPGVYPFLDTHKVADAFLAPALDKLARQEDEDGKLRFVDYKYLTVRELGAVY
EGLLEFSLKVAEEDLVVVKDDDREVYKPKAKLTAKEKPVAEVPKGKPYLVNDKTERHASG
SYYTPDYVVEYIVRRALEPVVAKRREALEKVLTEYAHWSKKQDKRPTKQNVERLTELRHK
ALDTLLDVKVVDPAMGSGHFLVGAVDFLSERFANLITELRAEPITDALAGLRDEIKAQMK
QYGLELKDEQLSDINLLKRMVMKRCVFGVDLNSMAVELAKLSLWLDAFTVGAPLSFLDHH
LRHGNSVLGVSRSEFVRWVERENPVWLSELEREVEEATRKAQELLSVRDLTPAEVELSQS
LYAHWEFEFPEVFFGPERKYNPGFDAVIGNPPYVRQEQLGPNKPFFEKAYESIYAGAADL
YTYFFARGLGVLREGGRLGFISSRQFTRAAYGEGLRKLLTAHTLLEITDFGENPVFEGVG
TFPAIFILEKGQPAYPIRYKAVSKAEFSALMEKPSEARAEELAQLVEGGQNLGPEAFRPE
GWTLGSADENAILRKMEENGVPLGAYVEGIYYGIKTGFNEAFFIDEPTRNRLIKEDSRSA
ELIKPLLVGDDVRHYYARWPKTYLILIPSSSHFDEGSWADSQIQEEAEQIFKETYPAIYK
HLVSWRDKLKARSDQGRWWWELRPCAYYQLLEAPKIVYPEIAKEPRFYLDYRGFYINKKL
FFIPRADWYLLAVLNSRVAFGILKLRLSALGDADEGGRLELRAVHLQHLPIPKVPHTTQA
SELEIALEEARKHYAQGEVSAALTWAEKELVAGCRDTVAAFLGFLAQEMQRMQAERLSLE
GGWRGWVEHAFQGTGKLGKEWLAEDWAREGLGVGVEAITERFKVKRVKTTPQTLAQLKMH
TQETLDQLRPLYQRLEATDRLIDRLVARLYGLTDEEAERLWATPSS
NT seq 4281 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatttgtcagaaggtcagactgaatctgttcccattagtttgaggaatcaagag
gccgagcgtctacgagattttgatgggttgttccaaatttacttggtgcgctacaaagcc
tacccacccacaaagcaagtggaggcctatctggccaaaacagggagttcggctctggtg
ctttttacaagtgatgaaaagagctttgttctctcttatgtagatggtgatcgggctatc
aatgctcgagcccaaaaagattgggtagagaacctacttaaagaccttctggagctttat
caggaaacgggcgatgtactgaagctgtcggagtcagctcaagatgccattcatgctcag
gccgatgaaaatataaatcgtcagaagcgcccctatcgtaaccaggggctttttagcgat
cactacctagatacccgtctccgggagagttcggagtggctggaggattcagagccgcta
aggaagaggctgctcgagctctacaaggacaaggaaagcctcctcaaagtagctaatgaa
gcccaaactgaagatgagtttatccggcccgtcctcgagtcccttggcttcgcttactgg
gtgcaagataccaccaaagccactggtgggcctcaacgcccagactacgtgctctacccc
gatgagggcacaaagagtagagctgttgtgcacaaagcaaacgaggccaagcggtacgcc
ccagccctggccatagccgaggccaagtactgggggcgtgaccttgatgtgaagcgaaag
gatggcagggatcgtgtacaaagcccggtcagcccatccttccagcttagtgactacctt
tcctctacgagcctggaatggggcattctgaccaatggccaggaatggcgactgtactgg
ggtaaagcagccgataagcagaagcgctacttcgcagtggatctggtacaggccctccag
gatcccgaggctttccgcttcttctggctgttcttccgtcgcgaggcctttacaaagggc
gcgcagggtagcttccttgggcgcattctcgagggcagcgagcagtacggcttgcgggtg
gggaaaaggctcaagggcgtggtcttcgaacaggttttccctcttctggccgaagggttt
ctgcgctaccacaagcaggtgcttaagcagccgccagacaaggctatgttgcaggagacc
taccgggccaccctgagcttgctctaccggctcttatttctgctgtatgccgaagaccgc
gacttgcttccggtttcggatacgttgggttatcagcagtacagcctttcacgcatccgc
cgcaacgttgccgaatggctagatcagggtcgagcttacagcgagcaatcctacagtctt
tgggagcgcctcagcacccttttcaccttcattgataagggggattctacgcttagggtt
cctccctacaacggagggctctttaagccaggggtgtatccttttctagacacccacaag
gtagccgatgcctttctggcccccgcgctggacaaactggcgcgtcaggaggacgaggac
ggcaagctccgttttgtggactacaaataccttacggtgcgggagctaggggccgtatac
gaagggttgctggaattcagcttgaaggtggcggaagaagacctggtggtggtaaaagac
gatgatcgcgaggtctataagccaaaggcgaagctcactgctaaggagaagcccgtcgcc
gaagtccccaagggcaagccctatctggtcaacgacaaaacggagcgccacgcctccggc
agctactacactcccgactatgtggtggagtacatcgtacgcagggctttggagccggtg
gtcgcgaagcgtagagaggcgctagagaaggttctgactgagtacgcccactggagcaag
aagcaggataagcgccccacaaagcagaacgttgagcggctgaccgagcttcgccacaaa
gcgctggataccctcctggatgtcaaggtggtagacccggccatgggctcgggccacttt
ctggtgggggcggtggacttcctttccgagcgctttgccaacctgatcaccgaactcagg
gccgaacccattaccgatgccctagccgggttgcgggatgagattaaggcgcagatgaag
cagtacggcctcgagctgaaagacgaacaactctccgatatcaacctgctcaagcgcatg
gtgatgaagcgctgcgtctttggggtggatctcaactccatggctgtggaactggccaag
ctctcgctgtggctggacgccttcacggtaggggcgcctctttctttcctggatcatcac
ctgcgccacggtaacagcgtgctgggggtgtccaggagcgagtttgtgcgttgggtggag
cgggagaacccggtttggctatccgagctcgagcgtgaggtggaggaggccacccgcaag
gcccaggagctcctaagcgtgcgcgacctcaccccagccgaagtggaactctcccaaagc
ctctacgcccactgggagttcgagtttcccgaggttttctttggcccggaacgcaaatac
aaccccggcttcgatgcggtgatcggcaacccgccctatgtgcgccaggagcagcttgga
cccaacaagccgtttttcgagaaagcctacgagagtatttacgcaggagctgccgacctg
tacacctacttctttgctaggggcctgggggtgctccgcgagggcggacggctggggttc
atctcttctcgccagttcacccgcgcggcctacggcgagggcttgcggaagctgctcacg
gcccacactctcctagagattaccgacttcggcgagaacccggtcttcgagggggtgggc
accttcccggccatcttcatcctggagaagggccaaccagcctaccccatccgctacaag
gcggtgagcaaggccgagttttcggcgctgatggaaaagccctcagaagctcgagcggaa
gagctggcccaattggtggaaggcggccagaacctaggcccggaggctttccgccccgag
ggatggaccctggggagcgccgacgagaacgccatcctgcgcaagatggaagagaacggg
gtgccgcttggggcgtatgtagagggcatttattacggtatcaagactggcttcaacgag
gctttcttcattgacgagcctacccgcaaccgcctgatcaaggaggactccaggagtgcc
gaactcatcaagcctctgttggtgggggatgatgtgcggcattactatgctcggtggccc
aaaacttacttgattttgataccaagtagcagccatttcgacgaaggttcatgggcggat
tcacaaattcaggaagaggcagaacaaatctttaaggaaacctaccctgccatctataaa
catctggtttcctggagagataagctgaaggcaagaagtgatcaggggcgctggtggtgg
gagcttagaccttgcgcttattatcaactcctcgaggcccccaagattgtgtaccccgaa
atagctaaggaaccgcgtttctatttggattacagaggcttctatatcaataagaaactc
tttttcattccccgagcagactggtatctcctggcagtgctgaactccagggtggctttt
ggcatccttaagctcaggctatctgcacttggcgatgcagacgaaggaggccgcttagaa
cttcgagctgtccacctccagcaccttcccatccctaaagttccccacaccacccaggcc
tcagaactggaaatagccttagaggaagctcggaaacactacgctcaaggggaagtttcg
gcagccttgacctgggctgaaaaggagctggttgcggggtgcagggatactgtggccgcc
ttcctgggcttcctggcccaggagatgcagcgcatgcaggccgagcggctgtcgcttgag
gggggctggcgagggtgggtggagcacgcttttcagggcacaggaaagctgggtaaggaa
tggttggcggaggactgggcaagggaggggctaggggtgggtgtcgaagccatcaccgag
cgcttcaaggtgaaaagggtcaagaccaccccccagaccctggcccagctcaagatgcac
acccaggaaaccctcgaccaactccgccctctttaccagcgcctggaagctaccgatcgg
ctcattgaccggctcgtggctcggctttacgggcttaccgacgaggaagcagaaaggcta
tgggctaccccatcgtcatag

DBGET integrated database retrieval system