KEGG   Meiothermus ruber DSM 1279: Mrub_0443Help
Entry
Mrub_0443         CDS       T01193                                 

Definition
(GenBank) hypothetical protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mrr_N
Motif
Other DBs
NCBI-ProteinID: ADD27220
Position
426746..427621
Genome map
AA seq 291 aa AA seqDB search
MSQPYSIGPYKGEVLLSLTGLFHVIRLIPPYPPRAVLEQILKERAMPTLVQWDNQVGLVG
PEQTLWVEAEQSWMEGLIRQLEPLDPLSAPEIAEQALLEKLVENAGSRLWAFLDDVNMLL
THGEMALETAQASRRYDRVATLAQWLERLLKVQQSGEALAELWGAFSGKKRSMPAKHPSK
KAPVPDKTRKRTKGAALPQKEYRLPILRALAELGGRGKTAEVLDRVYLQLKHLFTDGDLE
RAYDDPRRDEPIWRNRARWEIAALKEEKLVQSGGYGVLILTDKGAAYLHGA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaccatactccatagggccctataaaggggaggtgctgcttagcttaaccggc
ttattccatgtgattcgactgattccgccttatccaccccgtgcagttctcgagcaaatc
ctgaaggagcgggcaatgcccactttggtgcagtgggataaccaggtgggcctggtaggg
ccggagcaaactctgtgggtagaagccgagcaatcgtggatggaaggcttgatccggcaa
ctggagccgctagaccccctcagcgcgcccgagatcgccgagcaggccctgctagagaag
ctggtggagaatgctggaagccgtctgtgggctttcctggatgatgtgaacatgctgttg
actcatggcgaaatggcgctagagacggcccaggcatcccgccgttatgaccgggtagct
accctagcccagtggctcgagcgcctgctcaaggtgcagcagagcggggaagccctagcc
gagctttggggggctttctctgggaaaaagcgaagcatgcccgcaaagcatccttcaaaa
aaagcgccagtgcctgataagacccgcaagcgaaccaaaggtgcggccttgccacaaaag
gagtaccgtttgcccattttgcgtgcgctggcagaactggggggacgtggaaaaactgcg
gaggtgctggacagggtttatctgcaactgaaacatctttttaccgacggggacttggaa
agggcctacgatgatcccagacgggacgaaccgatatggcgaaaccgagcacgctgggaa
atagctgctttgaaggaagagaagctggtgcagagcggtggctatggggtactgattctc
acagataaaggagcagcctacctgcacggggcttag

DBGET integrated database retrieval system