KEGG   Meiothermus ruber DSM 1279: Mrub_0445Help
Entry
Mrub_0445         CDS       T01193                                 

Definition
(GenBank) helicase domain protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLDc_2 Helicase_C SNF2_N ResIII AAA_22 RE_NgoFVII Sec7
Motif
Other DBs
NCBI-ProteinID: ADD27222
Position
428790..431840
Genome map
AA seq 1016 aa AA seqDB search
MSANLQLPDFIDNDHLKLSEALNFLLRSQPQADIASGYFNLGGYALVKDALAEIPRLRIL
LSKEGGIAAGELYPAGFQKDLASAKFATRNRELAKELVQLLLRPEIEVRLYTKGFFHGKA
YIFGDVAIIGSSNFTHAGLTANTELNSVHKQGYAAQAAREWFERFWEQSQDYKLELVRLL
EESKLISSGYSPYLIFLKSLYEYFKDELTVDLEKGRNIGKSLVDLADFQQKAFERALKIL
EKYDGVFIADSVGLGKTWIGKKLLEHFGYFQRKKCLVIAPAQLSQMWEDELRSIQVAAHV
VSMESMGRSNFDASSYFDAEVVLVDESHNFRNSNQRYAALSRIMNAGRRKKAIMLTATPI
NNSVFDLYNQIMLFARGERYFARAGIPYLRGYFIRALEDGDLLNLLEEVMVRRTRQFVKQ
EFPEAVINGEPVRFPRRELHTERYDLEAIYPDLYKQVAVRFEELILAAYNPEAFLERPTD
KEELERQRNEALIGLIKSLLLKRFESSVEAFRISLRRQIAFHERFIEELMHGHLLSSADY
RRLIALENEEEVSSSVQSLPTVDASAYRVLELAQVAAADLEHLREMLRMVEPVAVENDPK
IAKLIELIRERPGKKIVVFSYFQDTIRYLEQAFRETYAESLQAVRWAVVDGSVRTKDRTD
ILRRFAPKSQKTQVAPEDELDLLLATDVFSEGQNLQDADTLINFDLHWNPTRMIQRAGRI
DRLGSPFEVIHIHNFFPEDGLEEMLGLLERLMEKIVQIDKNVGLDASILGEVINPKTFNA
LRRIEQEDARIADELEAEAEISSEFMRALLSTYLQKSGAERLEAIPYGVHSGMAGRGRRG
IFFHFKVGDEHIWRFYDVDKREILDSKYRIYNLIQCEEQTPRVDADYNVDDILAEVSRHL
LEDLNIQNAVQVDTLPKAQREVLTALRGLARHPQIDRQELIELLKNLNQPLSRVLVRELE
SIHKAYEAQPMELVKALRAFVEHYYLTQTDQSAQANRRFSEEDLELVVYLTLSATQ
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaacctgcaattacccgacttcatcgataatgaccaccttaagctttccgag
gctctgaattttctgttgcgaagccaaccccaagccgacattgccagtggttacttcaat
cttggaggctatgccttggtcaaagatgcgctggctgagattccccggctgcggatttta
ctctccaaagaaggaggaattgcagccggggaattgtatccagcgggcttccaaaaggat
ttggccagtgcgaagtttgctacacgcaaccgtgaactggctaaagaactggtacaactt
ttattgcggccagagatagaggtgcgactctacaccaagggcttttttcatggcaaggcc
tatatcttcggagatgttgctatcatcggctcttccaactttacccatgccgggcttacc
gcaaacaccgaactcaactcggtgcacaaacagggttatgcggcccaagccgcacgggag
tggtttgagcgtttttgggagcagtctcaggattataagctcgagctggttaggctcttg
gaagagtccaagctcatcagtagcggatacagcccctatctgattttcctaaagagcctg
tacgaatacttcaaggacgaacttaccgttgacctagagaaaggccgcaacattggtaag
tccctggtagacctagccgattttcagcagaaggccttcgagcgggccctaaagattttg
gagaagtacgatggggtctttatcgccgattcggtgggtttgggtaagacttggatcggt
aagaaactcctggaacacttcggctactttcagcgtaagaagtgcttggtaatcgcacca
gctcaactttcccagatgtgggaagatgaactccgctccatccaggtagctgcacacgtt
gtaagtatggagagcatgggacgctcgaactttgatgcgtcctcatactttgatgctgag
gtagtgctggttgacgaatctcacaactttcgtaattccaaccagcgatatgctgctctc
tctcgcataatgaatgctgggcggcgaaagaaagcaataatgctcacggcaacccccatt
aacaactctgtcttcgacctttacaaccagatcatgctctttgcccgtggagagcgttac
tttgcccgtgctggcattccttatttgcgtggctatttcatccgtgctttggaggatggt
gatctgctgaatttgcttgaagaggtgatggttcggcgtactcgccagtttgtaaagcag
gagtttcccgaggccgtcatcaatggtgaaccggtgcgcttccctaggcgtgaattgcat
accgagcggtacgacctagaagctatttatcccgatctctacaagcaagtagctgtacgc
ttcgaagagcttatcttggcggcctataatccagaagcttttctcgagagacccactgat
aaggaggagcttgaacgtcagcgcaacgaggctctaattggtctgatcaaaagtttgcta
ctcaagcgctttgagtcaagtgtggaagcatttcgtatttcattgcgtcgtcagattgcc
tttcatgagcgctttattgaggaacttatgcatgggcacctcctctcgagcgccgattac
cgtcgccttatagccctggagaacgaggaggaggtctcttcttcagtacaatcccttccc
actgtagatgcttcggcgtaccgagtattggagctggctcaggtagcagcggcagacctt
gagcacctacgcgagatgctgagaatggtggaacctgtggccgtggaaaacgaccctaag
atagccaagctgatcgagttgattcgcgagagaccaggtaaaaaaatagttgtgttttcc
tactttcaggataccatccgctatcttgagcaggccttccgagaaacctatgcagaatcc
ttgcaggctgtgcgatgggcggtggtggatggtagcgttcgcaccaaagaccgtacagac
attcttaggcgatttgcgccgaaatctcagaagacccaggttgctcccgaggatgagctg
gacctgctccttgccactgacgtattttctgaaggccagaacctgcaagatgctgataca
ctgatcaacttcgacctgcactggaaccctacacgtatgattcaaagagccgggcgtatt
gaccgactcggctctccgttcgaggtaatccatatccataacttttttcccgaagatggc
ctcgaggagatgctgggcttgcttgagcggctaatggagaagattgtacagatcgataaa
aacgtgggtctggatgctagtatcctgggtgaggtgatcaatcccaagacctttaatgcc
ttgcgccgcatcgagcaagaggatgcccgaattgccgatgaattagaggctgaggccgag
atttctagtgaattcatgcgggccttgctttctacgtatctgcaaaaatctggagcagaa
cggcttgaggctattccctatggggtccacagtggtatggcagggagaggacggcgaggg
attttttttcacttcaaagtaggagatgagcatatttggcggttctatgacgtggataag
agggaaattcttgactccaagtatcgtatatataacctcatccagtgcgaagaacaaacc
ccaagagtagatgccgattataatgttgacgacattctcgctgaggtaagtcgacacctg
cttgaggatttaaacatccaaaatgccgttcaagtggatacgcttcccaaagcccagcgt
gaggttctgaccgctcttaggggattagcccggcacccacagatagatcgtcaagaattg
atcgaactgttaaagaatctcaatcagccactttcacgagtgctggtgcgtgagctcgag
tctattcataaggcgtatgaagcccaaccaatggaactcgtgaaagcccttagagctttt
gtagagcattattaccttacccaaacggatcaatctgcgcaagcaaatcgtcgttttagt
gaggaagatctagaactggtcgtttatttgacgctaagtgcaacgcagtaa

DBGET integrated database retrieval system