KEGG   Meiothermus ruber DSM 1279: Mrub_0446Help
Entry
Mrub_0446         CDS       T01193                                 

Definition
(GenBank) transposase IS4 family protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1 DDE_5 DDE_Tnp_2
Motif
Other DBs
NCBI-ProteinID: ADD27223
Position
431926..432990
Genome map
AA seq 354 aa AA seqDB search
MHHHSELIEVLRPHLKWHRARLDFLSAFVLALIRVRSVNLAQIALALNPWVHIASNYRRC
QRFLAEFRLQQEVIGRLILKLLPQDPAHKLVLSLDRTEWTLGQASINLLFIGVAHQGVAY
PLVWCFLGKAGSSNLQERLGLLRRLLTFLPKERIQSLCADREFACTGFLRYLRWQQLPYT
LRIKAGNRVTYKGRSRPVQQLFRHLDYGAWEALPKPVKLWGQPTYLMGSRLRKGEYLLLI
TEAEPERAPARYARRWEIETLFKACKSQGFDFESTHLTRAERIESLVALMSIALVWAHRV
GEWRLQTQPIPIKNHARKLYSTFRYGLDYLRQLLFAPEARKAELYACVRLLSCT
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcatcatcatagcgaactcatcgaagttctacgaccccatctgaagtggcatcgcgcc
agactggattttctgtcggcctttgtgctggctttgatccgagtccggagtgtcaacctg
gcccagatcgccctggccttgaacccctgggtgcacatagcctccaactaccgtcgctgt
caaaggttcctggccgagttcaggttgcagcaggaagtcatcggacggctgatcttgaag
ctcttgccacaagacccggcgcacaagctggttttgagcctggatcgtaccgagtggacc
ttgggtcaggccagcatcaacctgctgttcattggagtggcccatcagggggtagcctac
cccctggtgtggtgcttcctgggtaaggccggtagcagtaatctgcaggagcgactgggc
ttgcttcgacggctgctcacgttcttacccaaagagcgcatccagtccctgtgtgcggat
cgggagtttgcctgtaccggttttctgcgctacctgcgctggcagcaactgccctacacc
ctgcgcatcaaagcggggaaccgggtaacctacaagggccgcagccgacccgtccagcag
ttgttccgacatctggactacggggcgtgggaagccttacctaaaccggtcaaactgtgg
gggcaacccacctacctgatgggcagtcgtttgcgaaagggggagtacctgctgctgatt
actgaggcggagccggagcgggcccctgcccgctatgcccggcggtgggagatcgagacc
ctcttcaaggcttgcaaatcgcagggcttcgacttcgaatccacccacctgactcgggct
gaacggattgagtcgctggttgcattgatgagcatcgctctagtctgggcgcatagggtt
ggtgaatggcgtctacaaacccagcccatccccatcaaaaaccatgcgcgcaagctctac
tccaccttccgctatgggcttgactatctacgtcaacttctctttgccccagaagctagg
aaagcagaactgtacgcttgtgtgaggcttttgtcgtgtacctag

DBGET integrated database retrieval system